[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55333.1


[Show Plain Result]

## Summary of Sequence Search
   1::499
   1::248  2.2e-53 25.7% 0050363 00503631 1/2   AD(P)-binding domain                    
   9::413  1.2e-48 30.7% 0045870 00458701 1/1   AD(P)-binding domain                    
   9::241  4.1e-48 31.7% 0052963 00529631 1/2   AD(P)-binding domain                    
   9::362  1.1e-41 27.3% 0048494 00484941 1/1   AD(P)-binding domain                    
   1::341  1.8e-41 28.6% 0043577 00435771 1/1   AD(P)-binding domain                    
 143::341  7.6e-40 35.5% 0050364 00503642 2/2   AD(P)-binding domain                    
   9::228  3.7e-39 26.2% 0046274 00462741 1/1   AD(P)-binding domain                    
   1::234  1.6e-34 21.7% 0049222 00492221 1/1   AD(P)-binding domain                    
   9::413  3.8e-33 26.6% 0049990 00499901 1/1   otide-binding domain                    
   1::413  3.6e-32 24.0% 0036092 00360921 1/1   AD(P)-binding domain                    
  11::227  1.5e-31 22.5% 0052911 00529111 1/1   AD(P)-binding domain                    
   1::341  1.9e-31 25.8% 0049150 00491501 1/1   AD(P)-binding domain                    
   5::344  1.1e-30 23.5% 0047022 00470221 1/1   AD(P)-binding domain                    
  11::389  1.3e-30 26.4% 0040660 00406601 1/1   AD(P)-binding domain                    
   1::385  3.1e-30 22.9% 0037441 00374411 1/1   AD(P)-binding domain                    
   1::270  7.9e-28 19.5% 0052926 00529261 1/1   AD(P)-binding domain                    
   5::235  1.1e-27 24.1% 0047141 00471411 1/1   otide-binding domain                    
   7::230  7.6e-26 18.7% 0047564 00475641 1/1   AD(P)-binding domain                    
  11::367  8.5e-26 23.3% 0046128 00461281 1/1   AD(P)-binding domain                    
   1::341  2.8e-25 26.8% 0040035 00400351 1/1   AD(P)-binding domain                    
   1::214  3.6e-25 22.6% 0036459 00364591 1/2   otide-binding domain                    
   5::250  7.4e-24 21.1% 0052313 00523131 1/1   AD(P)-binding domain                    
  11::342  1.5e-23 22.9% 0045881 00458811 1/1   AD(P)-binding domain                    
   1::342  2.8e-23 21.9% 0047327 00473271 1/1   otide-binding domain                    
  11::366  4.2e-23 23.9% 0047029 00470291 1/1   AD(P)-binding domain                    
   9::257  1.8e-22 19.9% 0046834 00468341 1/1   AD(P)-binding domain                    
   7::258  7.1e-22 27.0% 0048607 00486071 1/2   AD(P)-binding domain                    
   7::208    8e-22 19.4% 0048583 00485831 1/1   AD(P)-binding domain                    
 256::456  1.4e-21 23.1% 0050363 00503632 2/2   AD(P)-binding domain                    
 143::338  3.9e-21 34.3% 0052964 00529642 2/2   AD(P)-binding domain                    
   8::341  6.2e-21 21.8% 0046156 00461561 1/1   otide-binding domain                    
   9::190  7.4e-21 26.0% 0050927 00509271 1/1   AD(P)-binding domain                    
   7::212  1.3e-19 24.3% 0048865 00488651 1/2   AD(P)-binding domain                    
   6::273  2.2e-19 20.4% 0045797 00457971 1/1   AD(P)-binding domain                    
   7::341  2.4e-19 24.8% 0048016 00480161 1/1   otide-binding domain                    
   9::204  2.8e-19 24.8% 0048807 00488071 1/1   otide-binding domain                    
   9::140    5e-19 32.0% 0050364 00503641 1/2   AD(P)-binding domain                    
   9::199  1.6e-18 25.6% 0050960 00509601 1/2   AD(P)-binding domain                    
   1::341  2.3e-18 24.7% 0052032 00520321 1/1   AD(P)-binding domain                    
   7::214  3.1e-17 25.4% 0046750 00467501 1/2   AD(P)-binding domain                    
 147::340    2e-16 25.2% 0049679 00496792 2/2   AD(P)-binding domain                    
   7::169  2.5e-16 24.8% 0047270 00472701 1/2   AD(P)-binding domain                    
   7::140  4.8e-16 19.8% 0047133 00471331 1/1   AD(P)-binding domain                    
   1::344  1.3e-15 23.5% 0041341 00413411 1/1   AD(P)-binding domain                    
   9::269  1.4e-15 19.7% 0047712 00477121 1/1   AD(P)-binding domain                    
 144::341  1.4e-15 22.0% 0040619 00406192 2/2   AD(P)-binding domain                    
   9::140  1.8e-15 21.3% 0042446 00424461 1/2   AD(P)-binding domain                    
   6::139  2.5e-15 24.2% 0053321 00533211 1/1   AD(P)-binding domain                    
 144::341    4e-15 26.7% 0047271 00472712 2/2   AD(P)-binding domain                    
   9::428  5.2e-15 20.3% 0045795 00457951 1/1   otide-binding domain                    
   1::202  2.1e-14 22.2% 0045518 00455181 1/1   AD(P)-binding domain                    
   1::341    3e-14 24.6% 0035989 00359891 1/1   AD(P)-binding domain                    
   1::344  5.2e-14 24.7% 0046446 00464461 1/1   AD(P)-binding domain                    
   9::140  1.1e-13 25.0% 0040619 00406191 1/2   AD(P)-binding domain                    
   1::143  2.6e-12 21.6% 0048356 00483561 1/2   AD(P)-binding domain                    
   1::222  2.9e-12 18.3% 0047068 00470681 1/2   AD(P)-binding domain                    
   1::183  3.9e-12 17.5% 0046579 00465791 1/1   AD(P)-binding domain                    
   1::341    7e-12 23.0% 0049003 00490031 1/1   AD(P)-binding domain                    
 144::340  1.4e-11 24.2% 0036301 00363012 2/2   AD(P)-binding domain                    
   1::341  1.5e-11 30.3% 0040602 00406021 1/1   AD(P)-binding domain                    
   1::344  1.5e-11 24.7% 0046270 00462701 1/1   AD(P)-binding domain                    
   1::201  1.8e-11 19.0% 0040688 00406881 1/1   AD(P)-binding domain                    
   9::168  2.2e-11 21.6% 0038074 00380741 1/2   AD(P)-binding domain                    
  11::228  3.1e-11 17.6% 0047682 00476821 1/1   AD(P)-binding domain                    
   9::139  8.8e-11 29.0% 0049679 00496791 1/2   AD(P)-binding domain                    
   4::187  1.4e-10 19.5% 0044098 00440981 1/1   AD(P)-binding domain                    
   9::139  1.8e-10 24.5% 0038449 00384491 1/2   AD(P)-binding domain                    
   6::184    2e-10 19.3% 0046514 00465141 1/1   AD(P)-binding domain                    
 142::339    2e-10 22.4% 0044705 00447052 2/2   AD(P)-binding domain                    
   9::77   2.7e-10 30.9% 0046057 00460571 1/1   otide-binding domain                    
   9::140  6.5e-10 26.7% 0047271 00472711 1/2   AD(P)-binding domain                    
   6::142  6.8e-10 21.3% 0048199 00481991 1/2   AD(P)-binding domain                    
   1::341  1.4e-09 23.0% 0040049 00400491 1/1   AD(P)-binding domain                    
   9::139  1.6e-09 24.3% 0036300 00363001 1/2   AD(P)-binding domain                    
   9::139  2.5e-09 27.1% 0048866 00488661 1/2   AD(P)-binding domain                    
   8::460  2.8e-09 21.2% 0048771 00487711 1/1   AD(P)-binding domain                    
   9::139  3.4e-09 28.6% 0036301 00363011 1/2   AD(P)-binding domain                    
   9::138  6.3e-09 25.5% 0036654 00366541 1/2   AD(P)-binding domain                    
   9::139  8.8e-09 24.5% 0048009 00480091 1/2   AD(P)-binding domain                    
   9::140  9.3e-09 25.3% 0038468 00384681 1/2   AD(P)-binding domain                    
   9::139  1.3e-08 26.3% 0046972 00469721 1/2   AD(P)-binding domain                    
   9::139  1.7e-08 22.6% 0053322 00533221 1/2   AD(P)-binding domain                    
   4::274  2.4e-08 19.6% 0050148 00501481 1/1   AD(P)-binding domain                    
   1::140  2.7e-08 23.6% 0046416 00464161 1/1   AD(P)-binding domain                    
   9::137  2.9e-08 23.7% 0047565 00475651 1/2   AD(P)-binding domain                    
   1::341  3.1e-08 20.4% 0052600 00526001 1/1   AD(P)-binding domain                    
   9::139  3.3e-08 25.5% 0048045 00480451 1/2   AD(P)-binding domain                    
   9::140  5.5e-08 25.0% 0048584 00485841 1/2   AD(P)-binding domain                    
   8::138  1.1e-07 26.6% 0048365 00483651 1/2   AD(P)-binding domain                    
   9::137  1.1e-07 25.3% 0036889 00368891 1/2   AD(P)-binding domain                    
 142::341  1.1e-07 25.2% 0038468 00384682 2/2   AD(P)-binding domain                    
   9::139  1.2e-07 26.3% 0048200 00482001 1/2   AD(P)-binding domain                    
 142::340  1.4e-07 17.1% 0048866 00488662 2/2   AD(P)-binding domain                    
 143::342  2.3e-07 22.9% 0042446 00424462 2/2   AD(P)-binding domain                    
 161::351  2.9e-07 24.1% 0047909 00479092 2/2   )-binding Rossmann-fold domains         
   8::140    3e-07 20.9% 0037643 00376431 1/1   AD(P)-binding domain                    
   9::138  3.2e-07 26.4% 0044705 00447051 1/2   AD(P)-binding domain                    
   9::140  5.6e-07 29.2% 0050961 00509611 1/2   AD(P)-binding domain                    
  11::73   5.9e-07 25.8% 0044413 00444131 1/1   AD(P)-binding domain                    
 147::340  6.4e-07 26.0% 0048009 00480092 2/2   AD(P)-binding domain                    
 146::341  6.6e-07 17.1% 0050961 00509612 2/2   AD(P)-binding domain                    
   9::142  7.4e-07 29.9% 0045519 00455191 1/2   AD(P)-binding domain                    
 152::340  2.4e-06 20.2% 0053322 00533222 2/2   AD(P)-binding domain                    
   9::137  2.9e-06 19.4% 0041940 00419401 1/2   AD(P)-binding domain                    
 146::340  6.3e-06 20.5% 0048200 00482002 2/2   AD(P)-binding domain                    
   9::140  1.6e-05 21.6% 0046761 00467611 1/2   AD(P)-binding domain                    
   9::139  2.2e-05 24.2% 0046973 00469731 1/2   AD(P)-binding domain                    
   1::340  2.4e-05 23.5% 0046760 00467601 1/1   AD(P)-binding domain                    
   9::156    5e-05 23.6% 0047909 00479091 1/2   )-binding Rossmann-fold domains         
 153::340  5.6e-05 17.1% 0048045 00480452 2/2   AD(P)-binding domain                    
   1::199  6.5e-05 26.4% 0039664 00396641 1/1   AD(P)-binding domain                    
   4::87   6.5e-05 21.7% 0045481 00454811 1/2    N-terminal domain                      
 149::339  7.6e-05 17.5% 0036654 00366542 2/2   AD(P)-binding domain                    
   7::141  0.00011 25.3% 0048108 00481081 1/3   AD(P)-binding domain                    
 147::343  0.00013 20.2% 0045519 00455192 2/2   AD(P)-binding domain                    
 144::341  0.00014 19.0% 0036016 00360162 2/2   AD(P)-binding domain                    
   9::137  0.00015 27.0% 0052964 00529641 1/2   AD(P)-binding domain                    
 147::338  0.00015 20.0% 0036889 00368892 2/2   AD(P)-binding domain                    
   1::138   0.0002 21.4% 0045798 00457981 1/3   AD(P)-binding domain                    
   8::57   0.00037 16.0% 0044559 00445591 1/2   )-binding Rossmann-fold domains         
   9::139  0.00052 22.9% 0048364 00483641 1/2   AD(P)-binding domain                    
 148::340  0.00076 19.1% 0046972 00469722 2/2   AD(P)-binding domain                    
 149::340  0.00083 19.4% 0038449 00384492 2/2   AD(P)-binding domain                    
 146::341  0.00085 19.0% 0048584 00485842 2/2   AD(P)-binding domain                    
 146::339   0.0019 17.8% 0048365 00483652 2/2   AD(P)-binding domain                    
   9::65    0.0024 14.5% 0046357 00463571 1/2   )-binding Rossmann-fold domains         
   6::138   0.0039 21.6% 0038285 00382851 1/3   AD(P)-binding domain                    
   9::49    0.0066 45.0% 0046344 00463441 1/2   AD(P)-binding domain                    
 151::338    0.015 18.0% 0047565 00475652 2/2   AD(P)-binding domain                    
   9::140    0.016 22.8% 0036016 00360161 1/2   AD(P)-binding domain                    
 318::482    0.016 17.4% 0052963 00529632 2/2   AD(P)-binding domain                    
 146::272    0.034 17.9% 0041940 00419402 2/2   AD(P)-binding domain                    
   9::44     0.036 22.2% 0042534 00425341 1/2   )-binding Rossmann-fold domains         
 145::272    0.086 17.4% 0038285 00382852 2/3   AD(P)-binding domain                    
 174::341     0.12 21.8% 0046761 00467612 2/2   AD(P)-binding domain                    
 171::348     0.16 18.0% 0036300 00363002 2/2   AD(P)-binding domain                    
 148::340     0.23 23.3% 0046973 00469732 2/2   AD(P)-binding domain                    
 169::208     0.24 30.0% 0045481 00454812 2/2    N-terminal domain                      
 149::228     0.28 18.9% 0045798 00457982 2/3   AD(P)-binding domain                    
 172::439     0.36 21.9% 0038074 00380742 2/2   AD(P)-binding domain                    
 172::378     0.69 18.5% 0047270 00472702 2/2   AD(P)-binding domain                    
 318::341     0.83 41.7% 0048108 00481083 3/3   AD(P)-binding domain                    
 167::209     0.88 25.6% 0042534 00425342 2/2   )-binding Rossmann-fold domains         
 318::339     0.89 36.4% 0038285 00382853 3/3   AD(P)-binding domain                    
 145::344     0.98 21.0% 0048356 00483562 2/2   AD(P)-binding domain                    
 318::346      1.5 34.5% 0036459 00364592 2/2   otide-binding domain                    
 134::378      1.9 19.6% 0046344 00463442 2/2   AD(P)-binding domain                    
 174::343      1.9 17.9% 0048364 00483642 2/2   AD(P)-binding domain                    
 318::351        3 35.3% 0048865 00488652 2/2   AD(P)-binding domain                    
 321::339      3.9 36.8% 0045798 00457983 3/3   AD(P)-binding domain                    
 174::209      5.3 20.0% 0046357 00463572 2/2   )-binding Rossmann-fold domains         
 145::348      6.2 21.0% 0048199 00481992 2/2   AD(P)-binding domain                    
 321::349      6.3 34.5% 0048607 00486072 2/2   AD(P)-binding domain                    
 174::206      7.1 18.2% 0044559 00445592 2/2   )-binding Rossmann-fold domains         
 172::228      7.7 19.6% 0048108 00481082 2/3   AD(P)-binding domain                    
 318::351       15 38.2% 0047068 00470682 2/2   AD(P)-binding domain                    
 318::368       26 28.0% 0050960 00509602 2/2   AD(P)-binding domain                    
 318::351       33 38.2% 0046750 00467502 2/2   AD(P)-binding domain                    
   1::499


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTTEAIYKRTVIVGSGFAGLGMGAQLKRRGDHDFVIIERADDVGGTWRDNTYPGAACDVPSHLYSFSFH
00503631   1/2  ma.smsmkydvvIiGaGpaGlaaAlrLaraGl.kvtvlEkgprlGgtwrtgrypglllllpallyllldl
00458701   1/1  --------ydVvvvGAGiaGlaaAlrLaeaGltdvlvlEagdrvGGrartvrypgfrfdlgahvflgpgg
00529631   1/2  --------mptkkdVaiIGAGpaGLaaAllLaraGhdldVtvfErrdrpGGlwrttgrigsgldlgpsll
00484941   1/1  --------aakkydvvIiGaGpaGlaaAlrLara.GlkVtvlEkgdrlGGrsrtggypgfpiidsgallf
00435771   1/1  M.......kdVaviGAGiaGlaaAyeLara.GlkVtvlEardrlGGrsrtvgypgfrldlgaglipgsy.
00503642   2/2  ----------------------------------------------------------------------
00462741   1/1  --------mlMkkkyDviiiGaGpaGlaaAleLara.GlkVlvlEkgdrlGGtwasngipgipsdggaav
00492221   1/1  MmktpvliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeLarapGlkVlvlEkgdrlG
00499901   1/1  --------kkdvvviGAGiaGlaaAlrLaea.GhkVtvlEardriGGrsrtnggllipglrldlgahlfp
00360921   1/1  pplmmdeeydvvViGaGpaGlaaAlrLaraG.lkVlvlEr....gGrlasgripgklldggahllpglle
00529111   1/1  ----------llsnlplgrllpfllptslwldtlplpllellisraileralpdldmdkeyDVvIvGAGp
00491501   1/1  MirvcpalceslvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLaraGl.kVtvlEardrlGGr
00470221   1/1  ----m...yDVvviGgGiaGlaaAlrLara.GlkVlvlEagdrlGGrlrtvrlgggtsldlggivfpgly
00406601   1/1  ----------MddlpeeyDVvViGaGlaGlaaAaaLaraG.lrVlvlEkrdrlGGtsatsrypGfrfdvg
00374411   1/1  MpvligllesliidtalllgllpplsaskkydvvviGaGpaGlaaAleLara.GlkVtvlEardrlGGrl
00529261   1/1  lniksielflsiieraldeglvppsmemmmekydvvIiGaGpaGlaaAlrLlqlAaraGpdlkVtvlEkg
00471411   1/1  ----mstkkdvaiiGaGpaGlsaAiyLaraGlddvtvlEkndrlgGrll.ggipg...............
00475641   1/1  ------lldkeyDVvviGgGpaGlaaAlrlaraGl.kvlllEkgdrlgGtclnsgcipskalllaalgll
00461281   1/1  ----------glellllslltemmskeyDvvvvGaGpaGlvaAlrLaedaGlkVlvlEagdrlgGascip
00400351   1/1  M......eyDvvvvGaGpaGlaaAlrLara.GlkVlvlErgdrpGGtsltnggpgfkldlgaalllg...
00364591   1/2  mgrvcppcegaclllllagpvailllepaladelllgllplllpamskkkdvvvvGaGpaGlaaAlalar
00523131   1/1  ----ms..ydVvvvGAGiaGlsaAlaLarrGl.rvlllergdvlggascrnsggglakgllleelpalgg
00458811   1/1  ----------llydvvIiGaGpaGlsaAlrLara.GlkVlvlEkGplvnrdrlGGts..nggdg.rldlg
00473271   1/1  M.......yDviviGaGiaGlaaAyrLakaG.lkVlvlEkgdrlGGraatfrldgfrvdnvgahpfkgl.
00470291   1/1  ----------lllllslsllllllsslllmmskeyDvviiGaGpaGlvaAlrLaelaGlkVlvlEa....
00468341   1/1  --------smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvlEkgprpggrsrggglypggle
00486071   1/2  ------myD.vviiGaGpaGlaaAlrLara.GlkVlvlEk.drlGGtclnvgcipskallyagllpdele
00485831   1/1  ------lsedkeyDVvviGgGpaGlaaAlalaraG.lkVlllEkgpelggtclaaggipskallllalgl
00503632   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00461561   1/1  -------gkkvaviGaGpaGlaaAllLakalpghdvtvfEkgpvpggllrygiapd..............
00509271   1/1  --------vydvviiGaGpaGlaaAlrlara.glklsevlllek.drlggtil.................
00488651   1/2  ------mlpkdvviiGgGpaGleaalalarlglklevtliergdrlggtll.plgpgpll..........
00457971   1/1  -----sekydvviiGaGpaGlaaAlrlarlaglkvlliekg.rlgglllllayggil.............
00480161   1/1  ------tgkkVavvGaGpAGlaaAaqLaraldlseelghdvtvferlprpggllrygiapd.........
00488071   1/1  --------irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaAlal
00503641   1/2  --------epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaaelakag.levtvf
00509601   1/2  --------kdvvviGgGpaGleaAlalar..glkvtliergdrlggtrpllsgvipgkll..........
00520321   1/1  M...mdeeyDvviiGaGpaGlsaAlrLara.GlkVlvlEkgpllggtsgln.gggihaglskllldl...
00467501   1/2  ------kkkdvvvvGgGpaGltaAlrlarlgpdlevtliekgdrlggtpllpgvlggk............
00496792   2/2  ----------------------------------------------------------------------
00472701   1/2  ------ledllldllsmstkkdvvviGaGpaGleaAlalarl.glkvtlierg..lGgtll.nggpglsk
00471331   1/1  ------tmkydvviiGaGpaGlaaAlrlara.GlkvlllEkgprlgyktllalGgllltvglipgkallg
00413411   1/1  Mp.msseeyDvvViGaGpaGlaaAlrlara.GlkVlllEkgpvlgGtssrn.qggirldlgaipl.....
00477121   1/1  --------ektdVaIvGAGpaGlaaAlaLaraGl.dvtvlErrdrpggtalgrggalsprglelleelgl
00406192   2/2  ----------------------------------------------------------------------
00424461   1/2  --------vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpaGlaaAlyLarlGa.evtvierr
00533211   1/1  -----mekydvviiGaGpaGlaaAlrlara.GlkvlvlEkgprpgglsrlnggggaaldlpsklllrlld
00472712   2/2  ----------------------------------------------------------------------
00457951   1/1  --------yDVvIiGaGpaGlsaAlrLara.GldlgselkVtvlEkgdrlGGts.glnaglipp......
00455181   1/1  Ms.....eydvvviGgGpaGlaaAlrlaea.GlkvlvlEkgdrlgglsnrngipglrlllgalllrllel
00359891   1/1  Mk.eldeeyDvviiGaGpaGlsaAlrLaraG..kVlvlEkgpvlggtsgln.gggipggllld.......
00464461   1/1  MmplslllatalelplpalaldkkyDvvViGaGpaGlaaAlalara.GlkVlllEkgdrlGGtslta..g
00406191   1/2  --------krVvviGaGpaGldaArellkdldlllktdisdnaleallarlga.evtvvgRrgpliaaft
00483561   1/2  Mskk....ydvviiGaGiaGlsaAlrLara.GlkVlllEkgdrlGGtsgrnaglipgglrldaalllvrl
00470681   1/2  lllllmmmlhydvvviGgGpAGlaaAlrlarldpgarvlliekepglgynrgclpkklllaaaelldlll
00465791   1/1  m.....keyDvvIiGaGiaGlsaAlrLaka.GlkVlvlEkgdrpGgrgasgrnaggiapglgyddrllal
00490031   1/1  lMlpeslleplpalsaseeydVvViGaGpaGlaaAlalara.GlkVlllEkgprlggtscln..ggglpp
00363012   2/2  ----------------------------------------------------------------------
00406021   1/1  Ms.....eyDvvvvGaGpaGlaaAlrlara.GlkvlllEkgdrlggtsllgggllnagdildklgllaal
00462701   1/1  MMsplllalllllpllllaldeeydvvviGaGpaGlaaAlalaraGl.kVlllEkgdrlGGtslrs..gg
00406881   1/1  Ms...skeydvvviGgGpaGlaaAlrlara.Glkvlllekgdrlgglllagcipgkallaaalllrllel
00380741   1/2  --------keydvvviGgGpaGlaaAlrlara.Glkvlllekgdlgggclnvgcipgkrllaaaelydel
00476821   1/1  ----------lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlrLae..GlkVlvlEagg
00496791   1/2  --------PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAlylarlgl.kvtlierrdr
00440981   1/1  ---MeskkydvvviGaGpaGlaaAlylara.glkvtllekgprlggllntgcgpsklllpgall......
00384491   1/2  --------lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlgl.kvtvver.drlggtl..
00465141   1/1  -----eieydvvViGaGpaGlaaAlrlara.GlkVtviEkgprlggclnvgcipgkaldaaalllrllel
00447052   2/2  ----------------------------------------------------------------------
00460571   1/1  --------pmmskkkdvvViGaGiaGlsaAlaLara.GysVtvlErgdrpggtsgtnggllaaglvapll
00472711   1/2  --------PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarlgl.kvtller
00481991   1/2  -----klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgGpaGlaaAaylarl.
00400491   1/1  Mk...dleyDvvvvGaGpaGlaaAlalaragpdlkvaliekgplgggasclngggipakllle.......
00363001   1/2  --------mekydvvviGaGlaGlsaAlelaragl.dvtvlergprlggcllllsvpggrldp.......
00488661   1/2  --------srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlga.kv
00487711   1/1  -------kydvviiGaGiaGlsaAleLarrGlkdVtvlErgplpggggasgrnagllhaglayle.....
00363011   1/2  --------ppipgldlegvftlrtlddalalreallagkrvvvvGgGlaGleaAaalrrl.glevtlver
00366541   1/2  --------vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarl.gakvtvvergdrlg
00480091   1/2  --------ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarl.gaevtvvergdrlggll
00384681   1/2  --------kdVaViGaGpaGldaAlylarlgakkvtlverrdrlg.........................
00469721   1/2  --------dlpgvellltsddalalkelpkdvvviGgGpaGleaAlalarlga.kvtliergdrllglld
00533221   1/2  --------ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarl.gaevtvvergdrlggll
00501481   1/1  ---lmeleydvvviGgGpaGlaaAlylara.glkvtliekgplllyalgg................llly
00464161   1/1  M.....leydvvviGgGpaGlaaAlrlara.GlkvlliekgdrlGGtllntgcipgkalllgalllellr
00475651   1/2  --------pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarl.gakvtvvereprlggt
00526001   1/1  Mse....eyDvvvvGaGpaGltaAleLaraG.lkVlllEagdrvgGtslrngglphkglreladrliell
00480451   1/2  --------pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarl.gakvtlverrdrlgglld
00485841   1/2  --------rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAlalarlg.akvtvvergdrl
00483651   1/2  -------ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGleaAlalarlGa.kVtvierg
00368891   1/2  --------ppipglellltsddalellelpkdvvviGgGpaGleaAlalarlgl.kvtliergdrlggll
00384682   2/2  ----------------------------------------------------------------------
00482001   1/2  --------llpipglevltsdgaldllelpkdvvviGgGpaGleaAlalarlgl.kvtlvergdrlggtl
00488662   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00376431   1/1  -------eydvvvvGaGpaGlaaAlalara.glkvlllekgprlggllv....................g
00447051   1/2  --------arprllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlylarlga.kvt
00509611   1/2  --------lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlgl.kVtli
00444131   1/1  ----------MsdedyDviviGaGiaGlvaAarLakaG.lkVlvlEkgdrlGGtaatlgldglkfdlggs
00480092   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00455191   1/2  --------ppipgvellltsddalalkelpkdvvviGgGpaGleaAlalarl.gakvtlierrdrllgtl
00533222   2/2  ----------------------------------------------------------------------
00419401   1/2  --------lPdipglelvltsddalelkepkkvvviGgGyiGleaAsalrrl.gaevtliergdrllpll
00482002   2/2  ----------------------------------------------------------------------
00467611   1/2  --------gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpegakvtlvergdrllpcld.
00469731   1/2  --------dipglellltsddalalkelpkdvvviGgGyiGleaAaalarlg.aevtlvergdrll.pyl
00467601   1/1  M.....keyDvvviGaGpaGlaaAlrlarlgldkvlviekgpllggqtllllggtclnvgcipsklllla
00479091   1/2  --------mmsylplfldlkgkrVliiGgGpaGltaAlelakaGa.kvtlverdpr..............
00480452   2/2  ----------------------------------------------------------------------
00396641   1/1  MsylasaallaalpslletieyDVlviGgGpaGlsaAlelarlapdaGl.kValvEkgdlgggasgrsgg
00454811   1/2  ---tdlkgkrVvViGaGlsGlaaarlllrlG.aevtvldrrdrpggllllelgvefvlgslllelllead
00366542   2/2  ----------------------------------------------------------------------
00481081   1/3  ------aalliliaslglellpadylvlaigssdgaldlpklpkrvvvvGgGyiGlelAaalarllpelg
00455192   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00529641   1/2  --------krVvViGaGaSgldialelakv.aksvtllersdelggpw......................
00368892   2/2  ----------------------------------------------------------------------
00457981   1/3  aldleelpkrlvviGgGyiGlelAsalrrlgpdaaevtlvergdrl........................
00445591   1/2  -------pkkvaviGaGgvGlalAlllaaagggdVtlvDidpekleglaadlldile-------------
00483641   1/2  --------ydvviiGgGpaGltaaiylarlgpdlkvtliek.........ggtclyvgcllskalg....
00469722   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00463571   1/2  --------mKiaviGaGyvGlelAavla..lgheVtlvdinpeklealnegllpilelgldelve-----
00382851   1/3  -----elpkrvvviGgGliGlelAaalrellpklg.levtlveagdrl......................
00463441   1/2  --------krVlVvdgGgGpaGleaAealarrG.heVtlvealdrlggl---------------------
00475652   2/2  ----------------------------------------------------------------------
00360161   1/2  --------krVvviGgGpaGldaArlllksldellktdindlalealkrlggkeVtvveRrgpleapftl
00529632   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00425341   1/2  --------lsmvlkgkkvaviGaGliGlalalllallglgeVvl--------------------------
00382852   2/3  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00457982   2/3  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481083   3/3  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00382853   3/3  ----------------------------------------------------------------------
00483562   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00457983   3/3  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00486072   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00481082   2/3  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PNPNWSQVFSPGPEIQTYLQNFAQDEGLLPHLHFNRNMNNARWDEKEGRWHITTPGQVYIAQFLITGTGH
00503631   1/2  pllfglpppggggvdraelldylleaaerlgvedvirlgtevtsidfdedgvvvgvttedGetieadavv
00458701   1/1  .............elleylldlleelgleddlrlntevggarlllpdgkllvltsdlnalllelradali
00529631   1/2  rlleelglldelleeglsplypglrldvpkelygfpdfplpgwfpvfpgrkelldyladlaeklgv..ei
00484941   1/1  .................pellpyllellkelglelrlpdlggrvvvlpdgkvlgyd..............
00435771   1/1  ................pyllelleelglelairlntevggavllpdgglltvprdladllaellaladgl
00503642   2/2  ----------------------------------------------------------------------
00462741   1/1  ilgpellellrelgielgpkvpeildyllklldkfdllklleflskvngveyiegrasfldagkwevlte
00492221   1/1  Gts...rnggvipdgglldpelldlleelGlpfdlllpgggvv.dpaellralaealaeelgve..irlg
00499901   1/1  gsy.................ellldlleelgve..lrlntrvv.vdrdgklvtvpldldgleleadavvl
00360921   1/1  ellaglgdlaellalkpelvalledgaailllprgvrllaglglggssainagvylrvspadfdel.gaw
00529111   1/1  aGLsaAyyLakarPglkVlvlEkgdrpGGas...grnggilpsglltdellelleelgipfdpegpgggt
00491501   1/1  srtaglippgflldlgahvfpg..laplllelleelglelelltlagaavlalldgklidlpadvarlla
00470221   1/1  pallelleelglelallaldgellayldglvlelgi..dlntl..vvaldpdalevlledlee...lrad
00406601   1/1  gsllpgti.pg.llrllrelgledlell.....plglagvirgggsvvnalpdeaeallaelgvl.fpig
00374411   1/1  rtaripglgasldlggil.............fpglsprllellaelgleaelarllglrvlilldgtvvs
00529261   1/1  drlGGtsrtnggliprgleelldelgipgalldagfpydgllfvfgggfigledargllrlgagvtvvdr
00471411   1/1  ........falpaelldalaelaeklgveirlgtev...........dgvtvttedgetieadavvlAtG
00475641   1/1  lllgaalfglllllllllldlvllgaakralgaellrllaelaeklg....veillgtavtellkddggv
00461281   1/1  sgaglgadlgltllpglfdtll....agldgrdllarrgkvlggsslingmvylrglpedldelakllgv
00400351   1/1  ............pelleelgteaaellaergvrvlrgkg.............lgggstinadavvlatg.
00364591   1/2  aGl.kvtllekgdrlggrlllvggipg......................gvlpeelvealaelleklgve
00523131   1/1  .........vdrarlaaalaeaaealgve..irlgtevtdllleg..grvtgVrtadGetlradavvlAt
00458811   1/1  ahvfflllppgllellaelglplglelldlleelleelgidfllgkgvgglsaingvvlergsaedydal
00473271   1/1  .npelldllkelgledkldlrrlvllrgkvlggpsdlngllavr..........gdedlleakalllatg
00470291   1/1  GGtarnggyigskpdlgaalfg...elldelyelgle.................................
00468341   1/1  llrelgledeleelgvdflkalvvlldldlvlalrllgpdvtggerrpragvvdraellralleaaeelG
00486071   1/2  lleelglpllpgldipvlpgrkgggreellrylaealeklgveirlgtalfvdpnrVts....vtvtted
00485831   1/1  lllelaallgillllllldlllllrrllllllllaagvegllillgvevvvgvadgggvtvvtgdgetir
00503632   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00461561   1/1  .........frlpkelldrlielleelg..veirlntev..........gkdvtledllleydavvlAtG
00509271   1/1  ...llggvpsglllgaalllall.elleklgv..eillgtevtsidldggtvvgvttgdgetltad..vl
00488651   1/2  .........glldaeelaeylrelleklgv..evllgtevtsidgdgkg...vtledgetleadlvvlat
00457971   1/1  lrvgfiplkrl.aelleallelaeklg..veillgtevtdidlddd..vvvvltdgetitltadavvlAt
00480161   1/1  ..............frlpkevvdrlvdlledlgvefvlnvev............gvdvtldellleydav
00488071   1/1  ara.GlkVtllEardrlggrlllsggipgk......................vdpaellealaelaeelg
00503641   1/2  ertprigglwrgipypp.........................lgkelldyleeyarklglr..irfgtev
00509601   1/2  ...........deelaeylrelleklgv..evllgtevtsidgdgkg...vtlddge.leadavvlatG.
00520321   1/1  ...................rdlleelgvelllggaglvdprgvellgelg........leadalllatG.
00467501   1/2  ...........llaelllrllelllklgv..evllg.evtsidpdg...ktvtledgetleydllvlAtG
00496792   2/2  ----------------------------------------------------------------------
00472701   1/2  pll................lrvlgpelaeylrelleklgv..eillgtrvtsidrdgdtgrvtgvtledg
00471331   1/1  aalllelaelleelgvevtllellggdrvlprldldgpellkallealeklgv...illgt....veilg
00413411   1/1  ........................................dlleelgldlvkggdgltleagalvlatg.
00477121   1/1  ldallargvpldglvvvdgggrlaldfaelalgapgyvvdraellralleaaeelg..veirlgtrvtsi
00406192   2/2  ----------------------------------------------------------------------
00424461   1/2  prlggtllalgripakllglealllrllllllglglllpipgrvlpkellealaealeklgv....eill
00533211   1/1  lllelaellarlgaevlrlllglltllergdrllp..ellrallealeelgve..irlgt.vtei....-
00472712   2/2  ----------------------------------------------------------------------
00457951   1/1  ....glggplddrglalaeetlellrelgaelglldglvrpngalvl.......................
00455181   1/1  leelgipfdlpglgglflprggrvdgaelaaalaeaaeelgv..eillgtrvt.i....dggvvgvttdg
00359891   1/1  ...........................dllerlgedlliglallvdgdlvvvltgeg.leadalllatGa
00464461   1/1  gilldlgarllegl...............glldlleelleelgielr...........llrdgklvvalt
00406191   1/2  lkelerlpelggllry.......gipedkllkeflareiadlplrrlleellayllevadaeelg..vei
00483561   1/2  alesldalreliatgarplglpipgrdlgglllardaldldalpkrlavlgggllgvdelaellpllgse
00470681   1/2  elaglgllllvaagdldaeelvlalaelleelgvevllgtrvtgi......dpdgvtvtladgetitadk
00465791   1/1  akeslellkelgaelgidlfrppgklvvagggdiglllelaealrrlgvpvellspeelkellplldfpe
00490031   1/1  ggl..............rylag.lglldlleelaeelgidld...........flrdgllvlaldgegle
00363012   2/2  ----------------------------------------------------------------------
00406021   1/1  lvrl........................................................adalvlatga
00462701   1/1  illdgglrll...............eglglldrleelleelgield............llvdgrlvvala
00406881   1/1  laelgiellllpypgvdlslvplllrvlgaelaaalaealeelg..veillgtav....ve.dggrvtl.
00380741   1/2  relleelgipfdevllglllllgrggadgaelaaalaelleelgvevllgtavt.i......ddgr..Vt
00476821   1/1  rlggrgatpsgggflvdtgadwlfgtep..................................elglegrg
00496791   1/2  lggd...................................pelleyllelleklgv..eillgtevteie-
00440981   1/1  ...........gaelveallelleelg..veillgtevtsidldgg..gv.vltdgetieadavvlAtGa
00384491   1/2  ...............................dcilskallelleelgv..evllgtevteveldgggvv-
00465141   1/1  leelgvelrlppldglllpgvgdvlgaelaaalaealeelg..veillgtrvtei...d.ggvvgvtted
00447052   2/2  ----------------------------------------------------------------------
00460571   1/1  llpggip---------------------------------------------------------------
00472711   1/2  rprlggtl......................................dlllelleklgve..illgtevte
00481991   1/2  Glkvlliekgprlggtclnvgcipskallkaaelaeliellpglgvelllgglgldlaellerkdavvdg
00400491   1/1  ............................dllerlvvdllkggailvdedlvelldge.aleadalllatG
00363001   1/2  ...............eelvlalaelleelg..vevrlgtevtsidrdgdg...vtledgetleadavvl-
00488661   1/2  tlvergdrlggtlld................................eelaaallelleklgv..evll-
00487711   1/1  .......larlaresldllrelveelgid..frrygklvlatgeaelellr...................
00363011   1/2  gdrlllpyl................................rpelskallelleelgv..elrlgtevt-
00366541   1/2  gtld.................................pelskallelleklgv..evllgtevtaidv--
00480091   1/2  d.................................eelsllllelleklgv..elllgtrvtaidvdgdg-
00384681   1/2  .........fpafp...elvellkee....gveillgtavleilgddgkvtgvrvvrveldesgrvvvvt
00469721   1/2  .................................pelskallelleklgv..elllgtevtaidldgdgv-
00533221   1/2  d.................................eelslallellekl....gvelllgtrvtaidvdg-
00501481   1/1  vgcilskallllgilgeellarlreqleklg..veillgtrvtsidl...dggtvvltdgetieadavil
00464161   1/1  ellelgglflllpdldlelllelldalveelaaalaealeelgveillgtevt.i......edgrvgvtl
00475651   1/2  ld.................................pelskallelleklgv..elllgtevtaidgd---
00526001   1/1  eelgvelllntvvgalltlaellaeydavvlalglglatglagrglavprgrvlggssvin.gavylrad
00480451   1/2  .................................pelaaallelleklgv..elllgtrvtaidldgggv-
00485841   1/2  lgtld.................................pelsklllelleklgv..dlllgtkvtaidrd
00483651   1/2  drlggrlld................................eelalallellekl....gvelllgte--
00368891   1/2  d.................................pelaaallellekl....gvevllgtevtaidv---
00384682   2/2  ----------------------------------------------------------------------
00482001   1/2  .................................dpelsklllelleklgv..evllgtevtaiegdgdg-
00488662   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00376431   1/1  lipskllllrvlgaelaaalaealeelg..vevllgtevtsidrdgggvtgvllvttgdgetiradavvl
00447051   1/2  lierrdrlggtl......................................dlllellek....lgvei--
00509611   1/2  ergdrlggld..................................pelskallelleklgv..elllgtev
00444131   1/1  vih-------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00455191   1/2  .................................dpelskallelleklgvevllgt.......evteidg
00533222   2/2  ----------------------------------------------------------------------
00419401   1/2  .................................deelsllleelleelgi..dvllgtevteiekdg---
00482002   2/2  ----------------------------------------------------------------------
00467611   1/2  ................................pelsklllelleklgv..dvllgtevtaidvddktvtv
00469731   1/2  dcelskall..................................elleklgvdlllgtkvtaidrdddgv-
00467601   1/1  allpellelleglgvefdle..............................ekgvdldglrlaydklv...
00479091   1/2  .........................pelallllelleklgvevllgtrvteiakeylpelllgveveagd
00480452   2/2  ----------------------------------------------------------------------
00396641   1/1  giaaglrll.........................................ienylgl...dlaellvedl
00454811   1/2  lvvlspgvpldhpllel-----------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00481081   1/3  aeVtlvergdrl..............................lpglld..eelaelllelleklg..vel
00455192   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00529641   1/2  ...........................lgvvillnteveevtgdg.....vvledgtelleaDavil---
00368892   2/2  ----------------------------------------------------------------------
00457981   1/3  .........lpyldpelsklllelleklgv..evllgtkvtsidrgedgvvvvtledgetleadlvll--
00445591   1/2  ----------------------------------------------------------------------
00483641   1/2  .......llglldeelalrllelleklg..velllgtevtsidlegktvtllllvlgdgetleydklvl-
00469722   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00382851   1/3  ..........lpryldpelsklllelleelgv..elllgtkvtsiegdgdgvv.vtledgetleadlv--
00463441   1/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00360161   1/2  kelrelggllrygippdpldlallelelellpraldrlvellldlllelpdlllllallaeeegvefrfg
00529632   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00382852   2/3  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00457982   2/3  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481083   3/3  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00382853   3/3  ----------------------------------------------------------------------
00483562   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00463442   2/2  ---------------------------------------------------------------vviatg.
00483642   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00457983   3/3  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00486072   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00481082   2/3  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LADESYPTIPGLESFTGEKFHSARWDHNVSLKGKRIGVVGTGASAIQIVPEMAKIASELVVFQRTPSYII
00503631   1/2  lAtGalsrprlppsipgldltfkggvtlsavwsdgalallgllvdllpkrvvviGgG.sglelasalarl
00458701   1/1  latgal..prlppipgl..dlgevlhsagyeellrrlgldllgkrvvvigggasavela.alaragasvt
00529631   1/2  rlnteVtsverdg..dgvtvttedgepdgeeetleadaVvlAtGalsrprllgllpdipgldlfggrvlh
00484941   1/1  ..lglgalpdspealgleefpgrvvvigggyiglelagkrvrvgg................akvtllqrr
00435771   1/1  lleadavilAtGa..rprlppipgld.lkg..vltsrdll..dllgkrvvviGgGasgldiaealarlga
00503642   2/2  --epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaaelakaglevtvfertprig
00462741   1/1  dgwgifeeeltadaviiatGa..rpripdlipgl...gggvltsddyldledlpgklvdfvllalalaia
00492221   1/1  tevtdilrdg..grvtgvttedllvdkngvevtdgdggtiradavvlAtGar..prllelpgldlpgvpd
00499901   1/1  atGalsllprlpdipgldlfsleellsalgll..dllgkrvvvigggasgvdlaellarlgarvtllerl
00360921   1/1  gvtlddlepyfelaadalvlatG..srprlpplpgl..elggvlltaaealgldflgkrvvvigggasgv
00529111   1/1  vdgaalvralaeaaleelgve..irlgteVtdilvdgggvlwtvrvtGVvvndtgvaldgllkllvdpll
00491501   1/1  ..arlvrlldgleleadalilatG..arprlllpipgldlfgvlgrvllssdlllgllllgkrvvviGgg
00470221   1/1  avvlAtG..srprlppipg.edl.ggvlhsallldll...gkrvvvigggasgldlaellarlgaevtvv
00406601   1/1  yaellpfyerleklygvlgegylpdlpgasifkglpvhssfddreldldgkrvvvigsgasavrakavvi
00374411   1/1  ldgdld..fevlladgeeleadalilatGa..rprllpipg...fdgkgvltardlldllflgkrvvviG
00529261   1/1  gdllralaeaaeelGve..irlgteVtsierdedgrvtgVttedmeplkdGeekpvpveGetiradlvvl
00471411   1/1  al.rprllpipgldlpgvlgvhsllsavllgllllgkrvvvigggdigllaelalalarlgalkvtlver
00475641   1/1  vvtgdgetiradavilAtGar.....srvppipgldgpgvltsdtalellllpkrvvviGggyiglelal
00461281   1/1  egwgydellpyfkvaedglgltadaiiiatg..srprypgipg........plsvswaldldelpkrlvv
00400351   1/1  .adprllgipgldydfllpgvhsaedalgldllgkrvvviGggysgvelaealarlgapvtlldrsplar
00364591   1/2  irlgtrvt.........dg.vgvttedgetieadavilAtGar..pntllllrggivvdeylrtsvpgi.
00523131   1/1  Gafsr..lllllglelpvgptlgyalvtdllellgkrvvvvgggktgtelaldlrsigasvtlfqpgdrl
00458811   1/1  ....ipatgaedflgglflpaegilgatgsepfllpgvsllrvldsagalslafrgkrvvvrltyddnyf
00473271   1/1  .......pylpllpglsleevldsllgl..dllpklvlvigggviglelaellarlgaevtvlergd...
00470291   1/1  .ldgrrllfprgkvlGGsssinggvylrgskndfdlwaglaglegwsydellpyfkkaekliiatg..sr
00468341   1/1  ngrve.irlgtrvtsierdgelledleeypvtvtlenlseeeakpeelggkvagvllrklledgddgrvt
00486071   1/2  GetgelvpgetiradavvlAtG..arprvppipGldlpgvltagvllleglilvdelqntsvpgiyavgd
00485831   1/1  adavilAtGar..srvppipgld...lpgvltsrtaldllflgkrvvviGgGyiglelAlalarlgak--
00503632   2/2  ----------------------------------------------------------------------
00529642   2/2  --ePripdipglleefkgkvlhsaayrdpedfkgkrVvViGaGaSgldialelakvaksvtllersdelg
00461561   1/1  al.sprllgipged.lpgvvlaldflllgnllpgkrvvviGgalrlldgvigntaldvartlarlgakvt
00509271   1/1  AtG.....arprllllllvpgipgfdgkgvhtartlldldllgkrvvviG--------------------
00488651   1/2  Ga..rpntppipgldllgvldvrgaivvdellqtgkpvvvaggdvagleglllglllllelalvaarqgr
00457971   1/1  G..srprllpipgldl.egvltsptsildalalllellpgklv.viggGai.............vllaig
00480161   1/1  vlAtGat.kprllgipgldldgvysaldflfgynllldglyllgllargkrvvviGggntaldvartllr
00488071   1/1  veirlgtrv.......D..........dgetiradavvlAtGar..prllplpgld........------
00503641   1/2  ----------------------------------------------------------------------
00509601   1/2  .srpntpllpglelderggilvdetlrtsvpgvfaagDvagkpvlvvgagaegrlaaln-----------
00520321   1/1  ..rpfdlpipglelfgvrglltlldalkleplllssdlaggllypgkrvvvigggaille..........
00467501   1/2  a..rprllpipgldlegvltlrtlldalalrealldlllllkgkrvvvvGgGliGlelaaalaelglevt
00496792   2/2  ------PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAlylarlglkvtlierrdrlgg
00472701   1/2  etleadavvlAtGarsnpnilglegagll-----------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00413411   1/1  ....arpripplpglgvpgvltsdgalalrepgkrvvviggglsglel......................
00477121   1/1  l.eedgdgvtvtledggeeetieadlvvgAdGar..srvrrllgip...............prtsvgrvf
00406192   2/2  ---prvlpipGedlcgvlslrdfvgdynlhpaawllppdltgkrVvviGaGpaGldaArellkdldlllk
00424461   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00472712   2/2  ---PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarlglkvtllerrprlgg
00457951   1/1  ...........aigledadelarl..............gkrvavlgggel....................
00455181   1/1  etiradavilAtGalslplllglspntpgllleglgielderggivvdenlrtsvpglyaaG--------
00359891   1/1  ..pprlldipgldelgg..llsldal......ggrvvvigggviglelaral..................
00464461   1/1  gegle.adavllatGa..rprllpipgld.................llggrvvvigggviglelaralae
00406191   1/2  ----------------------------------------------------------------------
00483561   1/2  vtg-------------------------------------------------------------------
00470681   1/2  lvlAtGa..rprllpipgldlpgvlvlrtlddalalrellaallpkrvvvvGgGliGlelAaalarlgve
00465791   1/1  flgglytprggtvdpaelvralleaaeelG....veillgtev---------------------------
00490031   1/1  .adalllatGa..pprlldipgld.................llggrvvvigggvdglelaralae.....
00363012   2/2  ---ppipgldlegvftlrtlddalalreallagkrvvvvGgGlaGleaAaalrrlglevtlvergdrlll
00406021   1/1  ..rprrlgipglelp.................ggrvvvigggviale.......................
00462701   1/1  dealeadalllatGa..rprllpipgld.................llgglvvvigggviglelaral...
00406881   1/1  .dgetieadlvvlAtGarsllllgrrpntellllelagleld....rggivvdetlrtsvp---------
00380741   1/2  ldgetitadavilAtGar..prllglpg------------------------------------------
00476821   1/1  illprgkvlGGsslinggvlvrglpedfdal..glgwsyeellpyfkkaekllgvlgalr..........
00496791   1/2  ----------------------------------------------------------------------
00440981   1/1  r..prllglpgldlpgglealglelderggivvdetlrtsvpglyaa-----------------------
00384491   1/2  ----------------------------------------------------------------------
00465141   1/1  getieadavvlAtGarslllllgrrpntellglegaglelde.r--------------------------
00447052   2/2  -arprllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlylarlgakvtlierrdrl
00460571   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00481991   1/2  ee--------------------------------------------------------------------
00400491   1/1  arpr...lgipgsdlpgvllalg...........krvvvvgggviglelaaal.................
00363001   1/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00487711   1/1  ......................................................................
00363011   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00501481   1/1  AtG..........................................................vlvaigrrp
00464161   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00526001   1/1  aidfatgar.gipgwdldgvlpyfdrledslgv.lglpflgkrvvviGggpigvefaealarlgakvtl.
00480451   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00384682   2/2  -ftprvlpipgeeacglltadepvailflerlihsyavkdgppftgkdVaViGaGpaGldaAlylarlga
00482001   1/2  ----------------------------------------------------------------------
00488662   2/2  -srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlgakvtlvergdr
00424462   2/2  --vPrvlpipgidl..ggvlhaldfldpkalkgkkVaviGaGpaGlaaAlyLarlGaevtvierrprlgg
00479092   2/2  --------------------mmsylplfldlkgkrVliiGgGpaGltaAlelakaGakvtlverdpr...
00376431   1/1  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00480092   2/2  ------ppipgle.....gvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgg
00509612   2/2  -----lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlglkVtliergd
00455191   1/2  ..--------------------------------------------------------------------
00533222   2/2  -----------ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgg
00419401   1/2  ----------------------------------------------------------------------
00482002   2/2  -----llpipgle......vltsdgaldllelpkdvvviGgGpaGleaAlalarlglkvtlvergdrlg.
00467611   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00467601   1/1  ......................................................................
00479091   1/2  gvvtvvlgdgetiead------------------------------------------------------
00480452   2/2  ------------pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtlverrdrlgg
00396641   1/1  vkggaglvdedlve..........ilatgappavlelegl.gvpf.lrtsdgaldlkgg-----------
00454811   1/2  ----------------------------------------------------------------------
00366542   2/2  --------vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarlgakvtvvergdrlg.
00481081   1/3  l---------------------------------------------------------------------
00455192   2/2  ------ppipgve.....llltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtlierrdrll.
00360162   2/2  ---prklgiPGedlpgvfsardfvawynglpdaallepdltgkrVvviGgGpaGldaArlllksldellk
00529641   1/2  ----------------------------------------------------------------------
00368892   2/2  ------ppipgle.....llltsddalellelpkdvvviGgGpaGleaAlalarlglkvtliergdrlg.
00457981   1/3  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00469722   2/2  -------dlpgve.....llltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtliergdrll.
00384492   2/2  --------lpgve.....llltsddalaleelpkdvvviGgGpaGleaAlalarlglkvtvver..drlg
00485842   2/2  -----rPrvppipgld..lvltsddlldleelpkdvvviGgGviGleaAlalarlgakvtvvergdrll.
00483652   2/2  -----ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGleaAlalarlGakVtviergdrl
00463571   1/2  ----------------------------------------------------------------------
00382851   1/3  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475652   2/2  ----------pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgakvtvvereprlg.
00360161   1/2  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00419402   2/2  -----lPdipgle..lvltsddalelke....pkkvvviGgGyiGleaAsalrrlgaevtliergdrllp
00425341   1/2  ----------------------------------------------------------------------
00382852   2/3  ----srPrvlpipgldlegvlllrtledalellellelpkrvvviGgGliGlelAaalrellpklglevt
00467612   2/2  ---------------------------------gvlllltsddalalkelpkdvvviGgGyiGleaAlal
00363002   2/2  ------------------------------mekydvvviGaGlaGlsaAlelaragldvtvlergprlgg
00469732   2/2  -------dipgle.....llltsddalalkelpkdvvviGgGyiGleaAaalarlgaevtlvergdrll.
00454812   2/2  ----------------------------tdlkgkrVvViGaGlsGlaaarlllrlGaevtvldrrdrp--
00457982   2/3  --------iPgle.....lvltsddaldleelpkrlvviGgGyiGlelAsalrrlgpdaaevtlvergdr
00380742   2/2  -------------------------------keydvvviGgGpaGlaaAlrlaraGlkvlllekgdl...
00472702   2/2  -------------------------------ledllldllsmstkkdvvviGaGpaGleaAlalarlglk
00481083   3/3  ----------------------------------------------------------------------
00425342   2/2  --------------------------lsmvlkgkkvaviGaGliGlalalllallglgeVvlyDinpek-
00382853   3/3  ----------------------------------------------------------------------
00483562   2/2  ----arplglpipgrdlgglllardaldldalpkrlavlgggllgvdelaellpllgsevtgglrsprgg
00364592   2/2  ----------------------------------------------------------------------
00463442   2/2  .sapvvitqlpipgadl..arvltleevllgkaktgkrVlVvdgGgGpaGleaAealarrGheVtlveal
00483642   2/2  ---------------------------------ydvviiGgGpaGltaaiylarlgpdlkvtliekggtc
00488652   2/2  ----------------------------------------------------------------------
00457983   3/3  ----------------------------------------------------------------------
00463572   2/2  ---------------------------------mKiaviGaGyvGlelAavla.lgheVtlvdinpekl-
00481992   2/2  ----klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgGpaGlaaAaylarlGl
00486072   2/2  ----------------------------------------------------------------------
00445592   2/2  ---------------------------------pkkvaviGaGgvGlalAlllaaagggdVtlvDi----
00481082   2/3  -------------------------------aalliliaslglellpadylvlaigssdgaldlpklpkr
00470682   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PRMERKYTDGEKRLFQRNPHVIENLRSELFWGGENTFAQRRAIPRFLAEGKKLALDHLAAQVSDEELRAK
00503631   1/2  gakvtlverrprllprldpelvepllealeklgvevll--------------------------------
00458701   1/1  lllrsprlglltprggygalvealakale.........................................
00529631   1/2  salyldnldllplykhlfppkgkrvvviGgg---------------------------------------
00484941   1/1  ppfvlpllllglllllllll..................................................
00435771   1/1  evtvverrprllalld......................................alalllgllsldalaa
00503642   2/2  glwrgipypplgkelldyleeyarklglrirfgtevtsvdrdgwtvtgeeltleadavvlatGa.svprl
00462741   1/1  viGggasglelasalarl----------------------------------------------------
00492221   1/1  algilvleglplvlpenlqgkrvv----------------------------------------------
00499901   1/1  dglllpg...............................................................
00360921   1/1  elasalarlgagvtvv......................................................
00529111   1/1  llkllldletgegetir-----------------------------------------------------
00491501   1/1  aiglelalalarlgaevtlversp..............................................
00470221   1/1  lerrdrlllffp..........................................................
00406601   1/1  atGareralpapgldllgrspagalpllsrrflvdllpklllaggglvnlllasdstrylefkalpkslv
00374411   1/1  ggvsglelaealarllkilgaevtllersd.rllallddegqvdprglldalaealeel...........
00529261   1/1  AtGarssprlllleglgledgrgyi..pvdlpllertsvpgvfaaGDaahgvhplggqGi----------
00471411   1/1  rdrllpradpe....lvelleeegv---------------------------------------------
00475641   1/1  alarlgakvtvverrdrllp--------------------------------------------------
00461281   1/1  igggaiglelapflarlgakvtgvgrlpgll.plggvdpsalvaa.........................
00400351   1/1  lpp..........glls.....................................................
00364591   1/2  .faa------------------------------------------------------------------
00523131   1/1  lppfspelaaallralleqlpgvltltnagveeiirdglp------------------------------
00458811   1/1  ndeyqglpereklltlviiGgGn...............................................
00473271   1/1  .....................................................................g
00470291   1/1  pllpdlpgglllggdgiltselalsldllpklvvvigggaiglelapvlarlgakvtgvgrlprg.lpvg
00468341   1/1  vttedldtgGeeetiradlvvlAtGars..llrkllglelpgggv..-----------------------
00486071   1/2  vlgalllllllllllldlleellllllllelllllllgleltpvaiaa----------------------
00485831   1/1  ----------------------------------------------------------------------
00503632   2/2  ---------------------------------------------masmsmkydvvIiGaGpaGlaaAlr
00529642   2/2  gpw...................................................................
00461561   1/1  lverrgl.llpatpeelra....lleegvelllltspveilgdgrvvgvvlv..................
00509271   1/1  ----------------------------------------------------------------------
00488651   1/2  vv--------------------------------------------------------------------
00457971   1/1  rrpntellglegagleldrggivvdetlrts.vpgiyaaGdvag.gpklavvAlaeGrvaaen-------
00480161   1/1  lgasvtlverrgrll.....apaspkelrell......................................
00488071   1/1  ----------------------------------------------------------------------
00503641   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00520321   1/1  ......................................................................
00467501   1/2  lver------------------------------------------------------------------
00496792   2/2  d.....................................................................
00472701   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00413411   1/1  ......................................................................
00477121   1/1  laGDaahavhplggqGlnlAiedarllaealaaalrg..alpaaldayererrpraaav-----------
00406192   2/2  tdisdnaleallarlgaevtvvgRrgplia.aftlkelerlpelggllrygipedkll......keflar
00424461   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00472712   2/2  tl....................................................................
00457951   1/1  ......................................................................
00455181   1/1  ----------------------------------------------------------------------
00359891   1/1  ......................................................................
00464461   1/1  ......................................................................
00406191   1/2  ----------------------------------------------------------------------
00483561   1/2  ----------------------------------------------------------------------
00470681   1/2  vtlverad.rll----------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00490031   1/1  ......................................................................
00363012   2/2  pyl...................................................................
00406021   1/1  ......................................................................
00462701   1/1  ......................................................................
00406881   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00476821   1/1  kllvvigggaiglglalv----------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00447052   2/2  ggtl..................................................................
00460571   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00400491   1/1  ......................................................................
00363001   1/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00487711   1/1  ...................................................elaealralgvdvelldaa
00363011   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00501481   1/1  ntellkl..glelderggivvdelllrtsvpgvfaaGdvaggplrlavvAvaeGriaalaiagy------
00464161   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00526001   1/1  ......................................................................
00480451   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00384682   2/2  kkvtlverrdrlg.........................................................
00482001   1/2  ----------------------------------------------------------------------
00488662   2/2  lggtlld...............................................................
00424462   2/2  tllalgripakllglealll....................................rllllllglglllp
00479092   2/2  ......................................................................
00376431   1/1  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00480092   2/2  lld...................................................................
00509612   2/2  rlggld................................................................
00455191   1/2  ----------------------------------------------------------------------
00533222   2/2  lld...................................................................
00419401   1/2  ----------------------------------------------------------------------
00482002   2/2  gtl...................................................................
00467611   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00467601   1/1  ......................................................................
00479091   1/2  ----------------------------------------------------------------------
00480452   2/2  lld...................................................................
00396641   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00366542   2/2  gtld..................................................................
00481081   1/3  ----------------------------------------------------------------------
00455192   2/2  gtl...................................................................
00360162   2/2  tdindlalealkrlggkeVtvveRrgpleapftlkelrelggllrygippdpldlallelelellprald
00529641   1/2  ----------------------------------------------------------------------
00368892   2/2  glld..................................................................
00457981   1/3  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00469722   2/2  glld..................................................................
00384492   2/2  gtl...................................................................
00485842   2/2  gtld..................................................................
00483652   2/2  ggrll.................................................................
00463571   1/2  ----------------------------------------------------------------------
00382851   1/3  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475652   2/2  gtld..................................................................
00360161   1/2  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00419402   2/2  lldeelsllleelleelgidvllgtevteiekdgdgvlv....vvvlgdgetleadlvllAi--------
00425341   1/2  ----------------------------------------------------------------------
00382852   2/3  lveagdrllpryldpelsklll.......elleelgvelllgtkvtsiegdgdgvvvtledg--------
00467612   2/2  arllpegakvtlvergdrll.pcld.............................................
00363002   2/2  cllllsvp..............................................................
00469732   2/2  pyldcelskall..........................................................
00454812   2/2  ----------------------------------------------------------------------
00457982   2/3  ll.pyldpelsklllell----------------------------------------------------
00380742   2/2  ...............................gggclnvgcipgkrllaaaelydelrelleelgipfdev
00472702   2/2  vtlierglGgtllnggpglskpll..............................................
00481083   3/3  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00382853   3/3  ----------------------------------------------------------------------
00483562   2/2  tvdparlvralaea........................................................
00364592   2/2  ----------------------------------------------------------------------
00463442   2/2  ................................drlggllrlgipdpllerleelgveillgvavteilgd
00483642   2/2  lyvgcllskalg..........................................................
00488652   2/2  ----------------------------------------------------------------------
00457983   3/3  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00481992   2/2  kvlliekgprlggtclnvgcipskallkaaelaeliellpglgvelllgglgldlaellerkdavv....
00486072   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00481082   2/3  vvvvGgGyiGlelAaala----------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LTPSYEPGCKRVLISNTYYPALQSPITTLEASALSSINGSTVRAASGEEYELDILIFATGFEATEPPYAQ
00503631   1/2  ----------------------------------------------------------------------
00458701   1/1  .........................ndylealarlgveirlgtrvteilrdgggvtvttadGetieadav
00529631   1/2  ----------------------------------------------------------------------
00484941   1/1  ....glspdhligagplrggcdyrgggvfgcpggaglvlggrgslaeallealeelpGveirlgteVtei
00435771   1/1  lepllalellggllypdg..gpaalv..ealaeale.gveillgtrvteierdgggvtvtt---------
00503642   2/2  pdipgldlfggllahsflrrkirelvkdpelaelltplllflgkrvvvigggysgvlnrgn---------
00462741   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00499901   1/1  ........dgvldpkgglgallealleelgveillgtpvtei.........Ge.leadavvlatgldp..
00360921   1/1  ............................yrpdggrgalaralaraaeaagvtvltgtrvteierdggggr
00529111   1/1  ----------------------------------------------------------------------
00491501   1/1  ................................rlgpvlpaglsealaealeallGveirlg---------
00470221   1/1  ...........pdgqvdpag..lvralaealeallgveirlgtrvteierdgggvtVttadGet------
00406601   1/1  iigggvigvpatraeifsskllslaekrrlmkflgrlleyeelpel..vldldlrelaellrrlgldvtl
00374411   1/1  ................................................................lgveir
00529261   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00461281   1/1  ....................................................lakalerlgveiltntrv
00400351   1/1  ..pgdglldggdgalvaalaealerlgveillgtrvteilrdgggvtgVttedgeleldge---------
00364591   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00458811   1/1  ...........................................................dpg--------
00473271   1/1  llgggdgqiyprgg.agallealakgveirlntevtri.....e..dGetieadaVilaaGa--------
00470291   1/1  dgglsalvaa............................................................
00468341   1/1  ----------------------------------------------------------------------
00486071   1/2  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00503632   2/2  LaraGlkvtvlEkgprlGgtwrtgrypglllllpallyllldlpllfglpppggggvdraelldylleaa
00529642   2/2  ........................lgvvillnteveevtgdgvvledgtelleaDavi------------
00461561   1/1  .......................................................dgeekv---------
00509271   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00480161   1/1  ......................................eegveflfladpveidgdgrvvg---------
00488071   1/1  ----------------------------------------------------------------------
00503641   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00520321   1/1  .............................alaeaaeelGveiltgtevteierdggrvtgV---------
00467501   1/2  ----------------------------------------------------------------------
00496792   2/2  ..........pelleyllelleklgveillgtevteiegdgdgvtgvtledgeltgeeet----------
00472701   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00413411   1/1  ...lvgrgdgaalaralaeaaealgveiltgtevteilrdeggrvtgVvtadtkdGeevtirad------
00477121   1/1  ----------------------------------------------------------------------
00406192   2/2  eiadlplrrlleellayllevadaeelgveilfgttvveilg...dgrvtgvrlvrvelvt---------
00424461   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00472712   2/2  ..............dlllelleklgveillgtevteidgdgggvtgvtledgldgeeetle---------
00457951   1/1  .lladgvtgglrpdggrvdparlvrallealeelGveillg.evteierdg....dGe...adlvvlAtG
00455181   1/1  ----------------------------------------------------------------------
00359891   1/1  .................leaaeelpgveillgtevteilgdgdgvtvttgrvtgvvlrdla---------
00464461   1/1  ...................................aaeelgveillgtrvteilvdeggrvtgv------
00406191   1/2  ----------------------------------------------------------------------
00483561   1/2  ----------------------------------------------------------------------
00470681   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00490031   1/1  ..............................aaeelgveillgtrvtellvdeggrvtgvvl---------
00363012   2/2  ..........rpelskallelleelgvelrlgtevtsidrdgvvlddgttleadllvlAt----------
00406021   1/1  ..................eaaeelgveiltgtevtei.dgvvgvvledGeeltieadlvvl---------
00462701   1/1  ................................aeaaeelgveillgtrvteilvdeggrvtgvt------
00406881   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00447052   2/2  ................dlllelleklgveillgtevteiegdgdgftvtlvrllnlvdg-----------
00460571   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00400491   1/1  ..................aealealpgveillgtevtellgdggrvtgvvledgetgeevt---------
00363001   1/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00487711   1/1  elraleplldlpdllgglyvpdggvvdpaalaaalaraaealGveirlgtevtgierdggrvtgVrtadG
00363011   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00526001   1/1  ..vergglllpgdgvgdraslaralleaaealgveiltgtrvteilrdedggrvtgVetrd---------
00480451   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00384682   2/2  ................................fpafpelvellkeegveillgtavleilg---------
00482001   1/2  ----------------------------------------------------------------------
00488662   2/2  .............eelaaallelleklgvevllgtrvtaidvdgdgvtvtlvtlgdgetl----------
00424462   2/2  ipgrvlpkellealaealeklgveillgtevtsidrdggg....vtv.tgdggtleadavvl--------
00479092   2/2  ..pelallllelleklgvevllgtrvteiakeylpelllgveveagdgvvtvvlgdgetieadlvilAtG
00376431   1/1  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00480092   2/2  ..................eelsllllelleklgvelllgtrvtaidvdgdgvtvtledgg----------
00509612   2/2  ..............pelskallelleklgvelllgtevteidgd.vvlgdgetleadlvvl---------
00455191   1/2  ----------------------------------------------------------------------
00533222   2/2  ..........eelslallelleklgvelllgtrvtaidvdgdgvtvtledggeeetlead----------
00419401   1/2  ----------------------------------------------------------------------
00482002   2/2  .........dpelsklllelleklgvevllgtevtaiegdgdgvvvvvklvtlgdgetle----------
00467611   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00467601   1/1  ............daelaaalaelleklgvevllgt.vteiegddgrvtgvvvvrledget----------
00479091   1/2  ----------------------------------------------------------------------
00480452   2/2  ..........pelaaallelleklgvelllgtrvtaidldgggvtvtledgetleadlvv----------
00396641   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00366542   2/2  ..........pelskallelleklgvevllgtevtaidvdgdgvtvtvldvvlgdgetl-----------
00481081   1/3  ----------------------------------------------------------------------
00455192   2/2  .........dpelskallelleklgvevllgtevteidg......dgetleadavliAtGarp-------
00360162   2/2  rlvellldlllelpdlll........................................lla---------
00529641   1/2  ----------------------------------------------------------------------
00368892   2/2  ..........pelaaallelleklgvevllgtevtaidvdgdgvtvtllldgdgetle------------
00457981   1/3  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00469722   2/2  ...........pelskallelleklgvelllgtevtaidldgdgvtvvtledgetleadl----------
00384492   2/2  ..........dcilskallelleelgvevllgtevteveldgggvvvvlgltvevvvlgd----------
00485842   2/2  ..pelsklllelleklgvdlllgtkvtaidrdg....dgvtvvlllkdgdgetleadlvll---------
00483652   2/2  ...........deelalallelleklgvelllgtevteidgdgggvvvltdgetleadl-----------
00463571   1/2  ----------------------------------------------------------------------
00382851   1/3  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475652   2/2  ..........pelskallelleklgvelllgtevtaidgdgdgvvvvlllvdvvlgdg------------
00360161   1/2  ----------------------------------------------------------------------
00529632   2/2  -------------------------------------dgvtvttedgepdgeeetleadaVvlAtGal.s
00419402   2/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00382852   2/3  ----------------------------------------------------------------------
00467612   2/2  ................................pelsklllelleklgvdvllgtevtaidv---------
00363002   2/2  .....ggrldpeelvlalaelleelgvevrlgtevtsidrdgdgvtledgetleadavvlAtGarprv--
00469732   2/2  ..........................elleklgvdlllgtkvtaidrdddgvlvvvledg----------
00454812   2/2  ----------------------------------------------------------------------
00457982   2/3  ----------------------------------------------------------------------
00380742   2/2  llglllllgrggadgaelaaalaelleelgvevllgtavt.iddgrVtl.dgetitadavilAtGarprl
00472702   2/2  ...............................lrvlgpelaeylrelleklgveillgtrvtsidrdgdtg
00481083   3/3  -------------------------------------kgvtvtledgetleadlvllAtGl---------
00425342   2/2  ----------------------------------------------------------------------
00382853   3/3  -------------------------------------dgvvvtledgetleadlvllAt-----------
00483562   2/2  ........................aeelGveillgtevtsierdggvvgVttedGe.iradlvv------
00364592   2/2  -------------------------------------dgvgvttedgetieadavilAtGarpntl----
00463442   2/2  g.............................................velgeeleleaDlvvlatgftpnd
00483642   2/2  ......llglldeelalrllelleklgvelllgtevtsidlegktvtllllvlgdgetleydk-------
00488652   2/2  -------------------------------------dgkgvtledgetleadlvvlatGarpntppipg
00457983   3/3  ----------------------------------------vvtledgetleadlvllAt-----------
00463572   2/2  ----------------------------------------------------------------------
00481992   2/2  .........................................dgeelaaalaelleelgvevllgtav.--
00486072   2/2  ----------------------------------------tvttedGetgelvpgetiradavvlAtGa-
00445592   2/2  ----------------------------------------------------------------------
00481082   2/3  ----------------------------------------------------------------------
00470682   2/2  -------------------------------------dgvtvtladgetitadklvlAtGarprllpipg
00509602   2/2  -------------------------------------dgkgvtlddge.leadavvlatGsrpntpllpg
00467502   2/2  -------------------------------------dgktvtledgetleydllvlAtGarprllpipg


                         -         -         -         -         *         -         -:420
query           LIDGCDGLNLSEHWERGMQAYQSVAVAGFPNLLSINGPNTSLGHNSIVYIIESQIEYILGAMDYMSAIGA
00503631   1/2  ----------------------------------------------------------------------
00458701   1/1  vlatgarp....laell.gllgpelper...giiavdglpvgsllkvhlgfdepfPvpglfla-------
00529631   1/2  ----------------------------------------------------------------------
00484941   1/1  egdgggvtVtte----------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00503642   2/2  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00499901   1/1  ..laellgle....lperglivvdpglr...tgvpglylaGdaagpggp.gvtgaiasgrlaa-------
00360921   1/1  vtgVtledgegltgeevtiradlvvlaaGars...ttrllllsglglplppdlgvvgrnpgta-------
00529111   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00406601   1/1  iell.erllagldagplsapsaaialrlflgslgrygng-------------------------------
00374411   1/1  lgtrvteierdgggvtvtledgdgeeetieadlvv-----------------------------------
00529261   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00461281   1/1  trilrdgggkglrvtgv-----------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00470291   1/1  ................------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00486071   1/2  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00503632   2/2  erlgvedvirlgtevtsidfdedgvvvgvttedGetieadavvlAtGalsrprlppsipgldltfkggvt
00529642   2/2  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00503641   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00467501   1/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00457951   1/1  arsp..lllkl.........pllpvrgqilvleplatdlpgvfvigdptg.............gngllvg
00455181   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00483561   1/2  ----------------------------------------------------------------------
00470681   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00487711   1/1  e.ieadlvvlAaGawsn..ellell....glelpp...pdglpvigp.vtgvpglylagga....Gvtla
00363011   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00479092   2/2  a---------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00481081   1/3  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00457981   1/3  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00382851   1/3  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00529632   2/2  rprllgllpdipgldlfggrvlhsalyldnldllplykhlfppkgkrvvviGggasgldpplaeldaral
00419402   2/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00382852   2/3  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00457982   2/3  ----------------------------------------------------------------------
00380742   2/2  l.....................................................................
00472702   2/2  rvtgvtledgetleadavvlAtGarsnp------------------------------------------
00481083   3/3  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00382853   3/3  ----------------------------------------------------------------------
00483562   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00463442   2/2  el................dealrtsvpg------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00488652   2/2  l---------------------------------------------------------------------
00457983   3/3  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00486072   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00481082   2/3  ----------------------------------------------------------------------
00470682   2/2  l---------------------------------------------------------------------
00509602   2/2  lelderggilvdetlrts----------------------------------------------------
00467502   2/2  l---------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SIIEPTAEAEEAYVEHIQRNAVGTVWLDGGCNSWYVDQRTGRLTLIWPDFGYAFRDANGTFDAEGYEFRD
00503631   1/2  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00529631   1/2  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00503642   2/2  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00486071   1/2  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00503632   2/2  lsavwsdgalallgllvdllpkrvvviGgGsglela----------------------------------
00529642   2/2  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00503641   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00467501   1/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00457951   1/1  gtaelggl--------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00483561   1/2  ----------------------------------------------------------------------
00470681   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00487711   1/1  pasgrlladlilgglppld.laafdlerfllllalvglle------------------------------
00363011   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00481081   1/3  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00457981   1/3  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00382851   1/3  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00529632   2/2  arlgakvtllprrdellpalleeleelreegvefllllgpveieyldrllralgllplttgl--------
00419402   2/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00382852   2/3  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00457982   2/3  ----------------------------------------------------------------------
00380742   2/2  ...glpgitptllleaagv---------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481083   3/3  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00382853   3/3  ----------------------------------------------------------------------
00483562   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00457983   3/3  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00486072   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00481082   2/3  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           VPATAPATL-------------------------------------------------------------
00503631   1/2  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00529631   1/2  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00503642   2/2  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00486071   1/2  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00503632   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00503641   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00467501   1/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00483561   1/2  ----------------------------------------------------------------------
00470681   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00481081   1/3  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00457981   1/3  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00382851   1/3  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00382852   2/3  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00457982   2/3  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481083   3/3  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00382853   3/3  ----------------------------------------------------------------------
00483562   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00457983   3/3  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00486072   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00481082   2/3  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------