[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55378.1


[Show Plain Result]

## Summary of Sequence Search
   1::366
   1::192  2.3e-67 47.1% 0046314 00463141 1/1   -like                                   
   1::193  1.7e-65 45.8% 0047181 00471811 1/1   -like                                   
   1::192  2.3e-63 47.6% 0047232 00472321 1/1   -like                                   
   1::192  6.5e-62 50.5% 0046252 00462521 1/1   -like                                   
   1::193  5.6e-56 42.7% 0047235 00472351 1/1   -like                                   
   3::190    7e-53 38.5% 0040817 00408171 1/1   -like                                   
   3::365    2e-50 41.3% 0046113 00461131 1/1   -like                                   
 158::331  6.8e-49 39.9% 0048107 00481071 1/1   )-binding Rossmann-fold domains         
 157::333  1.2e-47 39.3% 0046253 00462531 1/1   )-binding Rossmann-fold domains         
   1::202  1.6e-47 37.7% 0048672 00486721 1/1   -like                                   
 158::331  2.6e-47 39.5% 0046114 00461141 1/1   )-binding Rossmann-fold domains         
 158::331    4e-47 38.5% 0046725 00467251 1/1   )-binding Rossmann-fold domains         
   1::203  4.9e-46 40.0% 0047654 00476541 1/1   -like                                   
 159::331  3.3e-45 42.1% 0048673 00486731 1/1   )-binding Rossmann-fold domains         
   1::169  7.5e-45 45.8% 0036743 00367431 1/2   -like                                   
   3::193  1.2e-44 40.5% 0039779 00397791 1/1   -like                                   
   1::194  1.4e-44 39.3% 0048862 00488621 1/1   -like                                   
   1::221  5.9e-44 39.1% 0046724 00467241 1/1   -like                                   
 158::332  7.4e-44 38.0% 0047655 00476551 1/1   )-binding Rossmann-fold domains         
 158::331  1.7e-43 36.8% 0051327 00513271 1/1   )-binding Rossmann-fold domains         
   3::193  3.5e-43 38.4% 0050001 00500011 1/1   -like                                   
   3::193    7e-43 43.9% 0043275 00432751 1/1   -like                                   
 158::337  1.1e-42 35.6% 0050203 00502031 1/1   )-binding Rossmann-fold domains         
   3::195  7.9e-42 39.1% 0042365 00423651 1/1   -like                                   
   3::196  1.3e-40 44.1% 0047994 00479941 1/1   -like                                   
 158::335  9.1e-40 35.5% 0051264 00512641 1/1   )-binding Rossmann-fold domains         
 158::331  6.4e-38 34.9% 0050204 00502041 1/1   )-binding Rossmann-fold domains         
 158::333  1.2e-37 36.7% 0048863 00488631 1/1   )-binding Rossmann-fold domains         
   4::192  4.1e-37 42.0% 0047104 00471041 1/1   -like                                   
 158::331  5.6e-37 37.3% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
 158::331  6.3e-36 36.4% 0038567 00385671 1/1   )-binding Rossmann-fold domains         
   5::124  9.6e-36 40.8% 0038267 00382671 1/2   -like                                   
   1::195  1.9e-35 40.7% 0051263 00512631 1/1   -like                                   
 161::344  2.2e-35 33.7% 0048799 00487991 1/1   )-binding Rossmann-fold domains         
   1::183  2.9e-35 38.2% 0050202 00502021 1/1   -like                                   
 158::339  3.2e-35 35.5% 0047481 00474811 1/1   )-binding Rossmann-fold domains         
   3::196  3.9e-34 38.4% 0046449 00464491 1/1   -like                                   
   1::193    5e-34 38.6% 0050889 00508891 1/1   -like                                   
   3::192    5e-33 34.5% 0042905 00429051 1/1   -like                                   
 169::316  1.1e-32 37.4% 0038711 00387111 1/1   )-binding Rossmann-fold domains         
 165::314  2.6e-32 40.1% 0036744 00367441 1/1   )-binding Rossmann-fold domains         
 158::333  2.1e-31 36.9% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
 168::312  3.5e-31 40.1% 0039780 00397801 1/1   )-binding Rossmann-fold domains         
 155::331  5.2e-31 30.0% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
   3::204  1.5e-29 38.1% 0049685 00496851 1/1   -like                                   
   1::193  1.6e-29 38.9% 0047480 00474801 1/1   -like                                   
 158::363  2.9e-27 32.9% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
 158::329  2.1e-26 31.0% 0050890 00508901 1/1   )-binding Rossmann-fold domains         
 168::332  9.8e-26 32.9% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
   4::207  2.3e-25 33.0% 0045092 00450921 1/1   -like                                   
 157::339    1e-24 32.8% 0050040 00500401 1/1   )-binding Rossmann-fold domains         
 158::333  3.9e-24 33.3% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
 181::311  9.9e-24 38.3% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
   3::210  5.4e-22 33.7% 0047846 00478461 1/1   -like                                   
   1::189  2.5e-20 32.4% 0041738 00417381 1/1   -like                                   
 160::331  9.3e-20 37.5% 0047847 00478471 1/1   )-binding Rossmann-fold domains         
 155::289  9.3e-18 33.3% 0044526 00445261 1/1   )-binding Rossmann-fold domains         
 189::329  7.2e-16 28.7% 0048454 00484541 1/1   )-binding Rossmann-fold domains         
 155::303  2.5e-13 26.2% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
 175::332  3.3e-12 20.9% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
 163::284    7e-12 30.5% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
 188::337  4.9e-10 20.9% 0052837 00528371 1/1   )-binding Rossmann-fold domains         
 172::345    1e-09 23.9% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
 182::262  1.1e-09 31.2% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
 165::298  2.7e-09 30.5% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
 177::343  3.3e-09 23.5% 0047580 00475801 1/1   nosyl-L-methionine-dependent methyltran 
 174::345  7.1e-09 23.1% 0046744 00467441 1/1   nosyl-L-methionine-dependent methyltran 
 172::305  1.8e-08 28.8% 0048469 00484691 1/1   )-binding Rossmann-fold domains         
 174::348  2.9e-08 22.8% 0051823 00518231 1/1   nosyl-L-methionine-dependent methyltran 
 171::305  5.5e-08 25.0% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
 176::346  1.1e-07 20.5% 0051885 00518851 1/1   nosyl-L-methionine-dependent methyltran 
 174::228  2.3e-07 32.1% 0049915 00499151 1/1   nosyl-L-methionine-dependent methyltran 
 174::322  3.9e-07 26.4% 0041580 00415801 1/1   nosyl-L-methionine-dependent methyltran 
   1::84     5e-07 39.2% 0044605 00446051 1/1   -like                                   
 174::289  6.7e-07 25.7% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
 174::284    8e-07 29.2% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
 174::353  8.4e-07 20.9% 0049122 00491221 1/1   nosyl-L-methionine-dependent methyltran 
 174::228  1.1e-06 38.5% 0046696 00466961 1/1   nosyl-L-methionine-dependent methyltran 
 176::338  1.4e-06 22.6% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
 186::308  1.8e-06 19.7% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
 186::308  2.2e-06 24.0% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
 176::346  2.9e-06 23.7% 0041326 00413261 1/1   nosyl-L-methionine-dependent methyltran 
 175::304  3.1e-06 23.2% 0046931 00469311 1/1   nosyl-L-methionine-dependent methyltran 
 173::341  4.2e-06 24.1% 0049532 00495321 1/1   nosyl-L-methionine-dependent methyltran 
 175::228    5e-06 35.8% 0048438 00484381 1/1   nosyl-L-methionine-dependent methyltran 
 175::228  6.7e-06 30.2% 0047471 00474711 1/1   nosyl-L-methionine-dependent methyltran 
 318::365  6.9e-06 37.5% 0036743 00367432 2/2   -like                                   
 176::353  2.8e-05 23.9% 0050234 00502341 1/1   nosyl-L-methionine-dependent methyltran 
 179::344  3.3e-05 23.5% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
 167::234  3.7e-05 35.8% 0046059 00460591 1/1   )-binding Rossmann-fold domains         
 175::228  4.2e-05 31.4% 0050745 00507451 1/1   nosyl-L-methionine-dependent methyltran 
 175::228  4.2e-05 36.0% 0051930 00519301 1/1   nosyl-L-methionine-dependent methyltran 
 170::228  4.7e-05 31.0% 0050988 00509881 1/1   nosyl-L-methionine-dependent methyltran 
 187::312  5.9e-05 22.6% 0050269 00502691 1/1   )-binding Rossmann-fold domains         
 174::353  6.5e-05 25.9% 0046838 00468381 1/1   nosyl-L-methionine-dependent methyltran 
 174::236    7e-05 32.8% 0047851 00478511 1/1   nosyl-L-methionine-dependent methyltran 
 186::287  8.9e-05 28.0% 0047278 00472781 1/1   )-binding Rossmann-fold domains         
 173::337  9.3e-05 21.8% 0050154 00501541 1/1   nosyl-L-methionine-dependent methyltran 
 156::228   0.0001 30.0% 0047923 00479231 1/1   nosyl-L-methionine-dependent methyltran 
 180::233  0.00011 32.1% 0042866 00428661 1/1   )-binding Rossmann-fold domains         
 148::232  0.00012 28.6% 0045243 00452431 1/1   )-binding Rossmann-fold domains         
 173::353  0.00012 21.2% 0051143 00511431 1/1   nosyl-L-methionine-dependent methyltran 
 174::228  0.00012 37.0% 0051884 00518841 1/1   nosyl-L-methionine-dependent methyltran 
 174::236  0.00017 27.4% 0049474 00494741 1/1   nosyl-L-methionine-dependent methyltran 
 176::228  0.00019 40.0% 0048629 00486291 1/1   nosyl-L-methionine-dependent methyltran 
 177::228  0.00024 31.4% 0047676 00476761 1/1   nosyl-L-methionine-dependent methyltran 
 188::262  0.00025 29.7% 0053383 00533831 1/1   )-binding Rossmann-fold domains         
 173::309  0.00026 26.9% 0049074 00490741 1/1   nosyl-L-methionine-dependent methyltran 
 188::228  0.00028 43.9% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
 176::228  0.00033 30.2% 0051944 00519441 1/1   nosyl-L-methionine-dependent methyltran 
 186::262  0.00033 23.7% 0053172 00531721 1/1   )-binding Rossmann-fold domains         
 176::228  0.00035 35.3% 0053107 00531071 1/1   nosyl-L-methionine-dependent methyltran 
 176::341  0.00036 21.2% 0046354 00463541 1/1   nosyl-L-methionine-dependent methyltran 
 173::231  0.00043 33.3% 0051103 00511031 1/1   nosyl-L-methionine-dependent methyltran 
 171::228  0.00045 32.1% 0050749 00507491 1/1   nosyl-L-methionine-dependent methyltran 
 172::304  0.00046 25.0% 0047386 00473861 1/1   nosyl-L-methionine-dependent methyltran 
 141::228  0.00047 29.9% 0048805 00488051 1/1   nosyl-L-methionine-dependent methyltran 
 184::240  0.00056 43.4% 0051305 00513051 1/1   )-binding Rossmann-fold domains         
 186::277  0.00066 21.3% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
 184::232   0.0007 36.7% 0047032 00470321 1/1   )-binding Rossmann-fold domains         
 175::229  0.00082 33.3% 0037982 00379821 1/1   nosyl-L-methionine-dependent methyltran 
 186::232  0.00083 34.8% 0047510 00475101 1/1   )-binding Rossmann-fold domains         
 176::228   0.0009 35.8% 0051261 00512611 1/1   nosyl-L-methionine-dependent methyltran 
 177::293  0.00091 28.9% 0048774 00487741 1/1   nosyl-L-methionine-dependent methyltran 
 125::204     0.49 25.0% 0038267 00382672 2/2   -like                                   
   1::366


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPAVFGHEGAGVVVAV
00463141   1/1  stagkvikmkAavlreagkpleieevelpepgpgevlvkvvatGiChtDlhvldgalpvplPlvlGHEga
00471811   1/1  stlgkvikmkAavlrgpgkpleieevelpepgpgeVlvkvvatGiChsDlhvldgllpvplPvvlGHEga
00472321   1/1  stagkvikmkAavlrgagkpleieevelpepgpgeVlvkvvatGiCgtDlhvldgllpvplPlvlGHEga
00462521   1/1  stagkvikmkAavlrepgkpleieevelpepgpgeVlvkvvatGvChtDlhvldgalpvplPvvlGhEga
00472351   1/1  stagkvikmkAavllgpgkpleieevelpepgpgeVlvkvvatGiChsDlhvldgelpvplPlvlGHEga
00408171   1/1  --lslvitmkAavltgpggpleleevpvpepgpgeVlvkvlaagicgtDlhilrglyplvklplvlGhEa
00461131   1/1  --lllslpltmkaavltgpggpleleevpvpepgpgevlvkvlaagicgsDllhirrglyplplPlvlGh
00481071   1/1  ----------------------------------------------------------------------
00462531   1/1  ----------------------------------------------------------------------
00486721   1/1  mtlslpltmkalvltgpgdpleleevpvpepgpgeVlvkvlaagicgsDlhilrglypvplplvlGhEga
00461141   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00476541   1/1  M..kalvltgpgd.leleevplpepgpgevlvkvlaagingsDlhlirlglyplllplvlGhEaaGvVve
00486731   1/1  ----------------------------------------------------------------------
00367431   1/2  atagkvikckAavlweagkplvieevevapPkagevlvkivatglChtdlhvlsgalpllfPvilGHega
00397791   1/1  --mkAavltgpgdpleleevpvpepgpgeVlvkvlaagicgsDlhilrglyplllllllllvklplvlGh
00488621   1/1  ltlsllmkamkalvlggpgpleleevpvpepgpgevlvkvlaagingsDlhirrglypvpklplvlGhEa
00467241   1/1  mstmkalvltgpgdpleleevpvpepgpgeVlvkvlaagingsDlhilrglypvplplvlGhEgaGvVve
00476551   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00500011   1/1  --mkaavvlggpgpleleevplpepgpgevlvkvlaagicgsDlhilrglypllklplvlGhEaaGvVva
00432751   1/1  --mkAlvltgpgdpleleevpvpepgpgevlvkvlaagicgtDlhiyrgglpllvklplvlGhEaaGvVv
00502031   1/1  ----------------------------------------------------------------------
00423651   1/1  --aaalpltmkalvltgpg.pleleevpvpepgpgevlvkvlatgicgtDlhilkgglplalvlklplvl
00479941   1/1  --smpltmkalvltgpgdpleleevplpepgpgevlvkvlaagingsDlhillglyplplklplvlGhEg
00512641   1/1  ----------------------------------------------------------------------
00502041   1/1  ----------------------------------------------------------------------
00488631   1/1  ----------------------------------------------------------------------
00471041   1/1  ---kAavllgpgdplrledvpvpelpgpgevlvkvaaagiCgtDlhilegllpglllvklPlvlGhEiaG
00405511   1/1  ----------------------------------------------------------------------
00385671   1/1  ----------------------------------------------------------------------
00382671   1/2  ----lilmkAvvvlatgdPkevlflkveeiplpalgpgevlvkviaagicgtDlailqgvyptkpvktig
00512631   1/1  etmkalvltgpggpevlelelevplpepgpgevlvkvlaaglnpsDllilsglyplvpplplvlghegaG
00487991   1/1  ----------------------------------------------------------------------
00502021   1/1  lpltmkalvltgpgdpleleevpvpepgpgeVlvkvlaagingsDlhirrglypvlplplvlGhEgaGvV
00474811   1/1  ----------------------------------------------------------------------
00464491   1/1  --kmkAlvllgpgdlrleevpvpepgpgevlvkvaatgiCgsDlhlykhgdlgdllvklPlvlGHEiaGv
00508891   1/1  petmkalvltgpggpevleleevplpepgpgevlvkvlaaglnpsDllillglyplvlplplvlgheaaG
00429051   1/1  --mkAlvlygagdpevlrleevplpepgpgevlvkvkavgingtDlkilsggypvlklplilGhEaaGvV
00387111   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00496851   1/1  --sktmkalvltgpgdpevleleevplpepgpgevlvkvlaaglnpsDllilrglyplvvplplvlGheg
00474801   1/1  mk..alvltgpgdpleleevplpepgpgevlvkvlaaglngsDllillglyplllelplvlGhEaaGvVv
00485161   1/1  ----------------------------------------------------------------------
00508901   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00450921   1/1  ---mkallllglgklellevpePepgPgevlvrtlavgvcgtDlhvldgdlpgvelgiilGheivGeVve
00500401   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00478461   1/1  --tmkavvylgpgkveveevplPelegpggkklegdvivkvtatgiCgsDlhilrgllpvelplvlGHEf
00417381   1/1  mkalvldelggpevlelvelplpelgpgevlvkvhaaglnykDllartglypvvpglplvpGlefaGvvv
00478471   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00446051   1/1  mvtnkqivlakrpegfPkpedfeleevplpepgdgevlvkvlylsv...DPymrgrmypvelgevmvggg
00479191   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00367432   2/2  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00460591   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00487741   1/1  ----------------------------------------------------------------------
00382672   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GSAVTSVKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFSEDGEQVGSHFFGQSTF
00463141   1/1  GiVeevGegVtdlkvGdrVvllfllsCgeCryCrsglenlCenlgvlvllgvlldgtlrfylvggpvl.h
00471811   1/1  GvVeevGegVtgvkvGDrVvllflpscgeCryClsglenlCenlgalnlggvlpggtaeltvdgklll.h
00472321   1/1  GiVeevGegVtdlkpGDrVvllfiisCgeCryCrsglenlCenlgvllllgvlldgtlafyvdgkll.gh
00462521   1/1  GvveevGegVtgvkpGdrVvllfllscgeCryClsgrenlCen.lglngvgllgdgterftadgkll.gh
00472351   1/1  GiVeevGegVtglkvGdrVvllflisCgeCryClsglenlCenlralgllgvlgggaerllvdgkvl.lh
00408171   1/1  aGvVvevGsgvtgfkvGdrVvvlpliscgeCraclsgrpnlcenlrllnlkgllldgtlrlslgg.lllg
00461131   1/1  EgaGvVvevGsgvtgfkvGdrVvvlpviscgeceaclsglenlcenllvlglagllldgtlrlllggksl
00481071   1/1  ----------------------------------------------------------------------
00462531   1/1  ----------------------------------------------------------------------
00486721   1/1  GvVvevGsgvtgfkvGDrVvvlflvscgeceaclsglenlcenlvlglggglllggttrlllggkpll.g
00461141   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00476541   1/1  vGsgvtgfkvGdrVvvlpvlscgeceaclsglenlcenll...................fglllgllldG
00486731   1/1  ----------------------------------------------------------------------
00367431   1/2  GivesvGegvtsvkpGdhvvllflpeCgeCklClsgktnlCeklrllglallgkgllldgtsrfslkgkp
00397791   1/1  EaaGvVvevGsgvtgfkvGdrVvvlpllscgecraclsglenlcenllflgl..................
00488621   1/1  aGvVvevGsgvdtgfkvGdrVvvlplvpscgeceaclsglenlcenllllllgllllg............
00467241   1/1  vGsgvtgfkvGDrVvglfiscgeceaclaglenlcenllllglggdlldgtlllsllglslllglllglG
00476551   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00500011   1/1  vGsgvtglkvGdrVvvlplviscgeceacrsglenlcenll..............llglagllllgllld
00432751   1/1  evGsgvtglkvGdrVvvlplliscgecryclsglpnlcenllflgv...lldG.................
00502031   1/1  ----------------------------------------------------------------------
00423651   1/1  GhEavGvVvevGsgvtglkvGdrVvvlpllscgecpyclagrynlce.....................gl
00479941   1/1  aGvVvevGsgvtgfkvGdrVvvlplvgscgeceaclsglenlcenllll....................g
00512641   1/1  ----------------------------------------------------------------------
00502041   1/1  ----------------------------------------------------------------------
00488631   1/1  ----------------------------------------------------------------------
00471041   1/1  vveevGegvtglkvGdrvvvllllscgtCraCraglenlCen....................llllGlll
00405511   1/1  ----------------------------------------------------------------------
00385671   1/1  ----------------------------------------------------------------------
00382671   1/2  nptgelpvvlGhEavgvViavGsnVsslkpGDrVvpivvsdgalaeyavvdena----------------
00512631   1/1  vVvevGsgvtgfkvGdrVvvllll..............................................
00487991   1/1  ----------------------------------------------------------------------
00502021   1/1  vevlGsgvtgdlslfkvGdrVvglpviscgeceacllsglenlc..............pnllllglnggl
00474811   1/1  ----------------------------------------------------------------------
00464491   1/1  VvevGsgvtglkvGdrVvveplvscgeceycrrgrynlcenl..lflglppldG................
00508891   1/1  vVvevgsg..gfkvGdrVvvlllv........................................lgllld
00429051   1/1  eevGsgvtglkvGDrVvvll..cg.............................................d
00387111   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00496851   1/1  aGvVvevgsg..gfkvGdrVvvlplv..........................................lg
00474801   1/1  ...........GdrVvvll................................................ldg
00485161   1/1  ----------------------------------------------------------------------
00508901   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00450921   1/1  vGsnveglkvGdrVvvpallscgtclycrrgllnlcd...................dlllgellglgrdG
00500401   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00478461   1/1  vGeVvevGsdvtnlkvGdrVvvpflisCgeCryCkagltslCenlnlgla..............gallGy
00417381   1/1  avgeg..gfkvGdrVvalgl..........................................glgetldG
00478471   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00446051   1/1  vgevve..sgvpgf--------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00367432   2/2  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00460591   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00487741   1/1  ----------------------------------------------------------------------
00382672   2/2  ------------------------------------------------------kpGDrVvpivvsdgal


                         +         -         -         -         -         *         -:210
query           ANYTNVSARSVVKVDDDVPLELLGPLGCGLSTGAGAILNSLGVRAGDTVAVFGTGAVGSAAIMAAAATGA
00463141   1/1  flglssfaeyavveelsvvkvdddlplelalllgclvltgigaaldllkvgk------------------
00471811   1/1  flggssfaeyavveeasvvkvdadlpllkagllgvlvlggigaalnllkvgkg-----------------
00472321   1/1  llgqssfaeyavvdelsvvkvdllkddlplllaallglgv.iglgavll.ak------------------
00462521   1/1  flglssfaeyavvdevsvvkvddlkldlpllivallgcgvitglgallnkg.------------------
00472351   1/1  llglssfaeyavvsealvvkvddllpldlvlllgcgvltgigaalnllkagks-----------------
00408171   1/1  gvlldggfaeyvvvparllvklpdglsleeaallellaltayhallragl--------------------
00461131   1/1  l.tldGlsgfaeyvvvparllvkilPdglslee.....................................
00481071   1/1  -----------------lpleeaaallcplltayhallrragvkpgdtVlvlGaGgvGllavqlAkalGa
00462531   1/1  ----------------glsleeaalllcalltayhalvrragvkpgdtVlvlGaGgvGllavqlAkalGa
00486721   1/1  flgdGgfaeyvvvpernlvkidPdglsleeaalllcagvtayaallaaa..........lgl--------
00461141   1/1  -----------------lpleeaaallcalatayhalvrragvkpgdtVlvlGaGgvGllavqlAkalga
00467251   1/1  -----------------lsleeaaallealltayhalvrragvkpgdtVlvlGaGgvGllaiqlAkalga
00476541   1/1  gfaeyvvvplaadllvklPldglslee...llcagltayllllalleraglkpgdtvl.....-------
00486731   1/1  ------------------pleeaaallcalltayhalvrragvkpgdtVlvlGaGgvGllavqlAkalGa
00367431   1/2  vl.hflglstFaeytvvdeisvvkiddda-----------------------------------------
00397791   1/1  ....lldggfaeyvvvpaallvklpdglsleeaallepalltalhallra.gl-----------------
00488621   1/1  ...ltldGgfaeyvvvpadllvklPdglsleeaallpca..tayhalv...glk----------------
00467241   1/1  gfaeyvvvpadllvkllPdglsleea............................................
00476551   1/1  -----------------lsleeaaalpeplltayhal.rlagvkpgdtVlvlGaGgvGllavqlAkalGa
00513271   1/1  -----------------lsleeaAalpealltayhalvr.aglkpgdtVlviGaGgvGllaiqlakalGa
00500011   1/1  GgfaeyvvvparnlvklPdglsleeaalllcagvtaygalvnlaklkpGegal-----------------
00432751   1/1  ..gfaeyvvvpaanlvklpdglslelaalleplavtahaall..agvlpgdtv-----------------
00502031   1/1  -----------------lsleeaAalpeagltayhalveraglkpgdtVlvlGaGgvGllavqlakalGa
00423651   1/1  lflgvlgldGgfaeyvvvpaanlvklpdglsleeaalleplavtahaalr..agl---------------
00479941   1/1  llldG..gfaeyvvvpadllvklPdg............................gd--------------
00512641   1/1  -----------------lsleeaAalplagltAylalvelaglkpgetVlvhGAaGgvGlaavqlAkalG
00502041   1/1  -----------------lsleeaaalplaglTAylallelaglklspgetvlvhGAaGgVGllavqlAka
00488631   1/1  -----------------lsleeaAallcagltayhalv.ragvkpgdtVlviGaGgvGllavqlAkalGa
00471041   1/1  dG..gfaeyvvvparllvklpdglldleeaalllealltalhavlra.gv.l------------------
00405511   1/1  -----------------lsleeaaallcagltayhallr.agllpgktvlvtGaGgvGlaaaqlaaalGa
00385671   1/1  -----------------lplellallGcglltaliglvevaklkpGktvlvlGlGgvGllalllakaaGa
00382671   1/2  ----------------------------------------------------------------------
00512631   1/1  .dggfaeyvvvpadllvklpdgllsleeaaalpl............agllkpget---------------
00487991   1/1  --------------------eeAAalplagltaylalveraglkpgetVlvtgaaGgvGlaavqlAkalG
00502021   1/1  llgllldGgfaeyvvvdpadllvklPdglllellsleeAlaAl---------------------------
00474811   1/1  -----------------lsleeaAalplagltAylalv.raglkpgdtVlvtGAaGgvGlaavqlakalG
00464491   1/1  ...gfaeyvvvpaallvklPdglslelaalleplllatalhavela.glklgdtvl--------------
00508891   1/1  G..gfaeyvvvpadllvklPdg.sleeaaavlplagl..ylallralggllk.-----------------
00429051   1/1  gglaeyvvvdedllvklPeslsllevleaaallvalltaysalrr.aglkpg------------------
00387111   1/1  ----------------------------pgltAyvglleiakvkpgetVlvlGaGgvGllavqlaklaGa
00367441   1/1  ------------------------llglafgtgfllllelagvlpgktVlvfGlGgvGlaaillakaaGa
00432761   1/1  -----------------lplelaaalglalltavlavla.agvkpgktvlvlGaGgvGlaaaqlakalGa
00397801   1/1  ---------------------------Caltvayaalkra.glkpgdtvlvvGaaGgvGllavqlakalg
00383791   1/1  --------------pkdvdlrvllllpeigltalealkrallelkpgsrVlviGaGgvGsaaaqllaaaG
00496851   1/1  llrdGgfaeyvvvpadllvklPdglsleeaa................................V------
00474801   1/1  gfaeyvvvpadllvklPdglsleeaaalplalgltaylallelaglkp...vl-----------------
00485161   1/1  -----------------lsleeaAalplagltaylallllldlagllpgktvlvtGAaggiGsaaaqlla
00508901   1/1  -----------------lsleeaAalplaglTAylalfalleraglkpgetvlvtGAaGgvGslavqlAk
00367461   1/1  ---------------------------lellsvalhallraglvpGktVlviGaGgiGlaaalaakalGa
00450921   1/1  afaeyvlvpaadaflvklPdelddeaaalleplsvtalrslvkrlavtpakavlvlGaGaigllvll---
00500401   1/1  ----------------glsleeaAalglaglTAylallelaklkpgetvlvhgAaGgvGsaaiqlakalG
00423661   1/1  -----------------lple.lgalvltlatavral.llagvlpgakVlvlGaGvvGlqaaalakalGa
00429061   1/1  ----------------------------------------aklkpgktvlvtGAaggvGlaaaqlakalG
00478461   1/1  ldlggldG..gqAeyvrvpladvlllklPdglsldealllladvlptgllalag.....aklgllvlgag
00417381   1/1  glaeyvvvpadllvplPdglsleeAaalptaglTAylaLvalarlklgp---------------------
00478471   1/1  -------------------iedlllLsDilPTGylaaela.gikpGdtvavfGaGPvGllaaasAlllGa
00445261   1/1  --------------pkslpllelallltglltawlplll.agllpgktvgviGlGgiGlavarlakalGa
00484541   1/1  ------------------------------------------------mmkklkvaiiGaGniGlalara
00374371   1/1  --------------agrlavleaalllervltglgal...agllpgkrvlViGaGgiGleaAaalarlGa
00484901   1/1  ----------------------------------lllldkllkllkpgdlvllllannlllpltlrvnkl
00496861   1/1  ----------------------AasilllgltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrG
00528371   1/1  -----------------------------------------------mkkvgiiGlGlmGlslalalara
00421801   1/1  -------------------------------DgigavsllkrllvdlpgkkvlvlGaGgiGralalalaa
00472761   1/1  -----------------------------------------ysrplllgligllgakvlpgkkvaviGaG
00423401   1/1  ------------------------aGylavllaalllcrflgglgllltlagglagkkvlviGaGgvGla
00475801   1/1  ------------------------------------llelldlkpgdrvLDiGcGt.Gylalalaklvg.
00467441   1/1  ---------------------------------ikrlvvllvlkglllsrlladalilvprhydlgedly
00484691   1/1  -------------------------------DgigavsllkrlgvdlpgkrvlviGaGgagraaalalla
00518231   1/1  ---------------------------------idcallaerlnkalellkdllkklevlrlilregdgl
00496711   1/1  ------------------------------nsvsglfdsiashydllndlyellldedyfysygyfddyg
00518851   1/1  -----------------------------------eldgqlldlllklikeklkknlglnldllplgegq
00499151   1/1  ---------------------------------Llvlgllielltpglrlllkvdelllserskyqeirv
00415801   1/1  ---------------------------------mekkelldwiaelldlgldlykleaellldevlgldr
00446051   1/1  ----------------------------------------------------------------------
00479191   1/1  ---------------------------------Ydlgndlyellldedyfysdayyddpgdllrpaqerl
00528071   1/1  ---------------------------------fdsyayfydalnllqlrprtealleallellglkpgk
00491221   1/1  ---------------------------------mstvplselskklaeeffydlaadfydllldglfpsq
00466961   1/1  ---------------------------------dlsndlyelyldlydlyssaydllgdrpltdalleal
00473291   1/1  -----------------------------------vkllkegdrvllelgrplmllellregglldtrlg
00425341   1/1  ---------------------------------------------lsmvlkgkkvaviGaGliGlalall
00355351   1/1  ---------------------------------------------GkkvaviGlGsmGlalAallaaaGh
00413261   1/1  -----------------------------------allel.gllkgkrvLDlGcGt.Gilaialakl.Ga
00469311   1/1  ----------------------------------erlfdeyaefydlanglglrprqeallelllellpl
00495321   1/1  --------------------------------tigellrealalleeagldlldaelllllllgldrlrl
00484381   1/1  ----------------------------------seildglvivgkydlskdlfeeflgdydlvlafldg
00474711   1/1  ----------------------------------ldgwfteilwpglrlllkldellheekskyqiiriy
00367432   2/2  ----------------------------------------------------------------------
00502341   1/1  -----------------------------------alklelllellglkpgkrvLDiGcGt.Gglalala
00484141   1/1  --------------------------------------dyiglvnllkklgldlkgktvliiGaGgvGla
00460591   1/1  --------------------------rseatgyGvvysllealkrlglvdlkgktvvvqGlGnVGsgaae
00507451   1/1  ----------------------------------llvlllllllalnkalkllrdllrklglpayrlvlg
00519301   1/1  ----------------------------------vllslfaerlvealkllkklllkglvnayrlvlgeg
00509881   1/1  -----------------------------kalldillwliellslglalslkidklleeekskyqiiriy
00502691   1/1  ----------------------------------------------kkvgiiGlGlmGlalarnlaaaGy
00468381   1/1  ---------------------------------edsllplllllldpllleallslleallegkydllel
00478511   1/1  ---------------------------------klkksfdnvakhYdlgndlyslildpdmfysygyydd
00472781   1/1  ---------------------------------------------ldifvkrlikelivvklpgkkvvvi
00501541   1/1  --------------------------------dvaeyfddiaavydgfaeglreaaeallelllellp..
00479231   1/1  ---------------efyddyalsfdeglrptqeellelllellglkpgkrvLDlGcGt.Gglalalakl
00428661   1/1  ---------------------------------------mfltlnvrelliklkllrlggleellvlalv
00452431   1/1  -------tisvaelalalllalarnlpgaapllragiwrasdllglelkgktvgviGlGriGlalarlla
00511431   1/1  --------------------------------qrellelllellglkpgkrvLDiGcGt.Gglalalakr
00518841   1/1  ---------------------------------dlikegdlvllllsrgnlllvllkllneggvlntryg
00494741   1/1  ---------------------------------kngikdeilldyilsrprgepldelldeyedyalkfg
00486291   1/1  -----------------------------------sydniaihydmlndrprtealleallellgllkgk
00476761   1/1  ------------------------------------lldllsllllelglvlsdeqleklealldllldw
00533831   1/1  -----------------------------------------------lellgvallevlgkrilkgkkva
00490741   1/1  --------------------------------ledllrayllllpellllleslenladhldlgnppfel
00479921   1/1  -----------------------------------------------pkkvaviGaGavGlalAlalara
00519441   1/1  -----------------------------------slprwlvinllkllgeellealleallellplvlr
00531721   1/1  ---------------------------------------------rrsrlllliglegqeklkgakVavi
00531071   1/1  -----------------------------------Gplriilgefrglklkvdpgvlirpttdrlrelll
00463541   1/1  -----------------------------------lllellglkpgkrvLDiGcGt.Gylalalarlggp
00511031   1/1  --------------------------------kllelldldidllklsllklkkinklyknlknlilknt
00507491   1/1  ------------------------------egeplriilgkleglklkldpgqafltprpvtellvdall
00473861   1/1  -------------------------------melfdevaeryddfadglspgqdrllelllellaellkp
00488051   1/1  vnvlkidseevleallkegrellltpglvpgksvygedygdplgeearlwdprrsrlaaklalilellgl
00513051   1/1  -------------------------------------------naesvaelalalllalarnlleaaall
00502281   1/1  ---------------------------------------------mmkvlitGAtGfiGselvrlLlehg
00470321   1/1  -------------------------------------------llGdntdglgavellerlggdlkgktv
00379821   1/1  ----------------------------------melveklkedgvivvedvldafrlvsknlflgervy
00475101   1/1  ---------------------------------------------gkkvviiGaGnvGralakvlralGa
00512611   1/1  -----------------------------------ellealnrklpltlrvntlkisreeilkhydlagk
00487741   1/1  ------------------------------------hqnfvnpllakllealdlrpgdrVLdlgcG.tGr
00382672   2/2  aeyavvdenaliklpdel....aalltlaaltalkaireletlydlllslgrlvlilgasgsvG------


                         -         -         -         +         -         -         -:280
query           TTIIAVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTV
00463141   1/1  ----------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00462521   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00408171   1/1  ----------------------------------------------------------------------
00461131   1/1  ......................................................................
00481071   1/1  srviavdlsdeklelakelGadhvinykdededlveavkeltgggvdvvldavggpatleaalellrpgl
00462531   1/1  srViavdlseeklelakelGadhvinykdledlveavkeltggrgvdvvidavggeatleaalelllrpg
00486721   1/1  ----------------------------------------------------------------------
00461141   1/1  srviavdlspeklelakelGadhvinpkdededlveavkeltgggvdvvleavgapaaleqalellrpgg
00467251   1/1  srViavdlseeklelakelGadhvinykdedlveavkeltgggvdvvldavggpatleaalealrpgGrl
00476541   1/1  ----------------------------------------------------------------------
00486731   1/1  srViavdlseeklelakelGadevinykdedkdlveavkeltgggvdvvldavggpatleqalellrpgl
00367431   1/2  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00467241   1/1  ...agviavds-----------------------------------------------------------
00476551   1/1  srViavdgspeklelakelGadhvinykdedlveavleltggrgvdvvldavggeatleaalellrpgGr
00513271   1/1  grViatdispeklelakelGadhvinyrdedlveavleltggrgvdvvidavggeatleaalellkpgGr
00500011   1/1  ----------------------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00502031   1/1  srViatdrspeklelakelGadhvinykdedlldlveavkeltggrgvdvvldavggpatleaalellrp
00423651   1/1  ----------------------------------------------------------------------
00479941   1/1  ----------------------------------------------------------------------
00512641   1/1  a.rViatagseeklelakelGadhvidyrdedlveavkeltggrgvdvvldtvgge.tleaaldllapgG
00502041   1/1  lGasrViatagseeklellvkelGadevinykeedlvealkeltgggvdvvldtvg.getleaaldalap
00488631   1/1  .rViavdrseeklelakelGadhvidykeedlvaell...gggvdvvldtvggpleltleaalellrpgG
00471041   1/1  ----------------------------------------------------------------------
00405511   1/1  .rViavdrseeklelarelgadvvidvtdedlveavleltg.gvDvvvdaagvpatleealrllkpggrl
00385671   1/1  grvigvdindeklelakelGathvvnyketekvaeevkeltdgegvdvvieavgspqtlreaisvlkkpg
00382671   1/2  ----------------------------------------------------------------------
00512631   1/1  ----------------------------------------------------------------------
00487991   1/1  a.rviatagseeklelakelGadhvinykdedfveavleltggrgvdvvldavg.getleaaldllapgG
00502021   1/1  ----------------------------------------------------------------------
00474811   1/1  a.rViatdrspeklelakelGadhvidyrdedl....altggggvdvvldtvgg..tleaaldllrpgGr
00464491   1/1  ----------------------------------------------------------------------
00508891   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00387111   1/1  grviavdgsdeklelakelGadavvnykdledlaealkeltggegvdvvldnvggeeallaalrlllkpg
00367441   1/1  grviavdlndeklelakslGadlvvnpkdldeevaeavleltgggvdvvveavgsvqallqaidavrpgw
00432761   1/1  .kVvavdiseeklelakelGadfvvvykdedvaeavleltg.gadvvidtagipgilreilrllkpggvi
00397801   1/1  aarviavdlsdeklelakelgadhvinskeedlveevleltggrgvdvvldavgaeatlelaldllapgG
00383791   1/1  vgkvilvDrdeealerarrlgpdvvvdpie.dlaeallellggrgvDlvldcvdnfetlallidalkpgg
00496851   1/1  ----------------------------------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00485161   1/1  alGa.rViavdrseeklellkelgadvvidvtdedaveal...agggvdvvvnnag.gatlgallellap
00508901   1/1  alGa.rViatagseeklellrelGadevidyk.dlveevleltggegvdvvldtvg.getleaalallap
00367461   1/1  .kViatdrspekleqakelgadfvvvykdlsediieavaellatngggadividtagipgileeavdllk
00450921   1/1  ----------------------------------------------------------------------
00500401   1/1  a.rviatagsdeklellkelGadhvinykeedfveevleltggegvdvvldnvg.getleaslkllapgG
00423661   1/1  geVtvvDisperleqaeelGadlvvvpseedlaeavreltgkqgggaDlvitaagipgvlrealevmkpg
00429061   1/1  a.rViatarseeklellkelGadvvidykdedlvealkeltggrgvdvvlnnvgge.tldaaldllapgg
00478461   1/1  ----------------------------------------------------------------------
00417381   1/1  ----------------------------------------------------------------------
00478471   1/1  ervivvDrvpeRLelaeelgaetidlseeddvlellkeltggrgvdaaidavGleahgsglellleedpa
00445261   1/1  .rViaydrspeklelakelgadfvvvysdedsleel....lkgaDvvilhvpltlaleevlellkpggvv
00484541   1/1  llalaggaevvavadrdpekaglalakelgatttvn.....avddleelladpgvDvvieatpagahaev
00374371   1/1  .kVtvvdrrpellerleelgakfvlltldeelvevvlaltvdvsdeegrlkavetleellgeaDvvivaa
00484901   1/1  kltrfgllnvlelsgknavahydlsndvyellldpaysdslarfgegntllqpelaelllelldlkpgkr
00496861   1/1  y.kViaidrseekleklkelgadvvldvt..dveellkallklggvdvvihtag.apvtelslsllkqll
00528371   1/1  GfadeVvgydrnpeklekalelgatdliaatdlaealkdaDvvilavptpavrevleellpllkpgaili
00421801   1/1  aga.evvvvnrtlekaeelaeelga.....qgdvsdleeleeal.ggaDivvnatgaglpglllelllel
00472761   1/1  gvGlalAlalaaagaagevtlvDideekleglardlldilellgvglvvttd------------------
00423401   1/1  aarllaalGa.kVtvldrnpekleqleelgadavevdvsdtadleelvaea..Dvvinaagipgatapll
00475801   1/1  grvtavdispealelarenaerlgl.dnvevilgdaeellfe..dgsfDlvvsdaplphlleellrlLkp
00467441   1/1  geelakvyddlaafldglrsrqeallelllellglkpgkrvLDlGcGt.GglalalakllgagrvtgvDi
00484691   1/1  lga.evtvvnrtlekaeelaelladevvaldlddleeal.....ggaDlvinatgagmaglvlplllsll
00518231   1/1  pglavdrygdwlvvlllealgeeeleelleallellpelrvnllkisredlleelldelielllgerdll
00496711   1/1  lglrpaqeallelllellglkpgkrvLDiGcGt.Gglalalakalga.rvtgvDispemlelarenaael
00518851   1/1  yieelwpglalslkvdevlhekkskyqiiriydlgndgrrlfldggvqysrlderqleelllllalldlk
00499151   1/1  yelgddgrvllldgllqg----------------------------------------------------
00415801   1/1  aglllgdrgltleelakflelierrlegepleyllglyeflglefgtgpgvfiprpttelllelllellg
00446051   1/1  ----------------------------------------------------------------------
00479191   1/1  lelllellglkpgkrvLDiGcGt.Gglalalakalg.arvtgvDispemlelareraaelglpnrvefvv
00528071   1/1  rvLDlGcGt.Gglalalakr.gakrvtgvDisp.mlelarenaaenglpnrvefivgDa.edl.plpdgs
00491221   1/1  relldlllellglkpgkrvLDlGcGt.Gglalalakr.ga.rvtgvDispemlelarenaaelglsdadd
00466961   1/1  lellglkpgkrvLDlGcG----------------------------------------------------
00473291   1/1  iepledllgvprglfldlavgylvlilrpltedlveafgrgtqitqpavaalllellglkpGarVLDlGc
00425341   1/1  lallglgeVvlyDinpekleglaadladilelllvkgrirattdlyealkgaDvviiavgvprkpgliae
00355351   1/1  .eVlvwdrdpekveelaelgapvakylpglellgrlrattdleealadaDvvilavptpavrsvlaelap
00413261   1/1  akvtavDispealelarena..gnvefivgdaee.lp....gkfDlivsNPPyvplsdilllevldlepl
00469311   1/1  kpgkrvLDlGcGt.Gglalalak.lgpkrvtgvDisp.mlelarenaaenglpnrvefivgDaedllepl
00495321   1/1  llllllplsvlelllllellerrllgepveyllgerefyglafkvgggvftprpttelllelllellp.k
00484381   1/1  lrsraerllelllellgl----------------------------------------------------
00474711   1/1  dlgndgrvllldglvlgs----------------------------------------------------
00367432   2/2  ----------------------------------------------------------------------
00502341   1/1  krg..arvtgvDispemlelareraae........lglpnvefvvgDaedlpfpdgsfDlvvsnavlhhl
00484141   1/1  iaqalaalGakkVvlvdrd................eekaqalveqlkelgskikvkavsldvgdveelee
00460591   1/1  lllelgakvv.vsDidpegldlae----------------------------------------------
00507451   1/1  egdllrglavdrygdwlv----------------------------------------------------
00519301   1/1  dllrglavdrypdwlvvl----------------------------------------------------
00509881   1/1  dlgnfgyelfldgrllys----------------------------------------------------
00502691   1/1  .eVvvydrspeklealaalgaevaaslaealadadvvilavplpaavkavlnglaellallkpgail.id
00468381   1/1  lfgkelfeylagdaelydlfndglrpgserlldlllellpllkpgkrvLDiGcG.tGglalalakalPga
00478511   1/1  pdetlrpaqelllelllellglkpgk--------------------------------------------
00472781   1/1  GaGpvGlalAlalallgavgkVvlvdideekleglalelidillpklvdvvvttelkevlkg.aDvvila
00501541   1/1  pgkrvLDiGcGt.Gglalalakr.gar.vtgvDispemlelarer.......aaelgl..nvefvvgDae
00479231   1/1  gp..kvtgvDispealel----------------------------------------------------
00428661   1/1  yydddadlellkgkkiaviGyGs-----------------------------------------------
00452431   1/1  alGa.kVivydrspekleeldg------------------------------------------------
00511431   1/1  gp..rvtgvDispemlelareraaelglpn.vefvvgDaed.lp.fpdgsfDlvvsnavlhhlpdpeall
00518841   1/1  vlkhddligklygsflds----------------------------------------------------
00494741   1/1  lglliiqpellalllelldlkpgkrv--------------------------------------------
00486291   1/1  rVLDvGcGt.Gilslala----------------------------------------------------
00476761   1/1  npvinltgsrefdelwlr----------------------------------------------------
00533831   1/1  viGaGgvGlalAllllelgvaaeVtlvDiddelleglalelgdiisllgkal------------------
00490741   1/1  llgeeffeyfakvyelydafndglrpatrlllelllellglkpgkrvLDiGcG.tGglalalakalPga.
00479921   1/1  GaageVvlvdrdeerlea----------------------------------------------------
00519441   1/1  vnellaelgielerdelg----------------------------------------------------
00531721   1/1  GaGgvGlalAllLalagvagevvlvDidevklsnlardllhiladlgvpkvv------------------
00531071   1/1  elladllkgkrvLDlgcG----------------------------------------------------
00463541   1/1  dgrvvavDispealelarenaerlgl.dnvefilgdaedllfe..dgsfDlvvsdaplehlleellrlLk
00511031   1/1  snvskeeiakfydlvadffde-------------------------------------------------
00507491   1/1  elgllkgkrvlDlGaGt.----------------------------------------------------
00473861   1/1  gkrvLDiGcG.tGglalalakllgepga.rvtgvDispemlelarer.......aaelglsdnvefvvgD
00488051   1/1  kpGdrVLDlGcGs.Gglt----------------------------------------------------
00513051   1/1  ragiwrllpllglelagktvgviGlGriGr----------------------------------------
00502281   1/1  dhevtaldrrtsagkllne..pgvevvegdltdpddlekalk.gvDvvihaagtsrvdeslkdalgt---
00470321   1/1  lviGaGgiGravaralaaaGak------------------------------------------------
00379821   1/1  gegvvkpqdegatiwaphr---------------------------------------------------
00475101   1/1  .evtvydidesrleeldgrvvd------------------------------------------------
00512611   1/1  vydlfyivprgefllldp----------------------------------------------------
00487741   1/1  lalaLakr.ga.rvigvDispealeqarenaelnglvsevgdllvysadnvefivgDafdlppadlgsvd
00382672   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GLVGAPAPGAEATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLVRTYPLEHINDAF
00463141   1/1  ----------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00462521   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00408171   1/1  ----------------------------------------------------------------------
00461131   1/1  ..................................................................litg
00481071   1/1  GrivlvGvpggplpl.lpllllllkeltllgslvggrlvleelpellella-------------------
00462531   1/1  GrivlvGvpg.gpllplpllllllkgltilgslvgg...redlpelldllasg-----------------
00486721   1/1  ----------------------------------------------------------------------
00461141   1/1  GrvvlvGvpggplp..lpllllllkeltllgslvggrrdleellellelgl-------------------
00467251   1/1  vlvGvlggplllpldllllllkeltllgsllggrlpleelpellellleGk-------------------
00476541   1/1  ----------------------------------------------------------------------
00486731   1/1  GrvvlvGvp.ggplpllpllllllkgltllgslvgsrapr.dlpelldlla-------------------
00367431   1/2  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00476551   1/1  ivlvgvlggglllplplpllllllkeltllgsllg...tredlpellellae------------------
00513271   1/1  ivlvgvlgggnllelplpllllllkgltlvgsllgt..raelleealdlla-------------------
00500011   1/1  ----------------------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00502031   1/1  gGrlvlvgvlsgpllllplpllllllkgltlvgsllgt...redleelldllasgkl-------------
00423651   1/1  ----------------------------------------------------------------------
00479941   1/1  ----------------------------------------------------------------------
00512641   1/1  rlvlvgllsg...lpldllllllkgltllgsllgtll.lelleelldllaegklk---------------
00502041   1/1  gGrivliglas.gyvleldlllllllllllllllkgltllgfllgslpell-------------------
00488631   1/1  rlvlvGlp..ggplpldllllllkgltilgslvg...sradleelldlvaegk-----------------
00471041   1/1  ----------------------------------------------------------------------
00405511   1/1  vlvgvagg..llpldlarlllkgvnlrgsflg...traalpellellaggk-------------------
00385671   1/1  Gtvvlvgvpsg.plellpivllvlssktvrgslvggrvpleelpealkrle-------------------
00382671   1/2  ----------------------------------------------------------------------
00512631   1/1  ----------------------------------------------------------------------
00487991   1/1  rvvlvGlas.gailplpllllllkgltllgsllgsrldlrellllvalgkilplvlithllele------
00502021   1/1  ----------------------------------------------------------------------
00474811   1/1  lvlvglls.ggplplpllllllkgltllgsllgs....rlleelldllaegklkpvili-----------
00464491   1/1  ----------------------------------------------------------------------
00508891   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00387111   1/1  GrvvlvGvis.gyvlplpllelllkrltlrgfivgd----------------------------------
00367441   1/1  GtvvlvGllgk..elelplv.lvlngltlrGslv------------------------------------
00432761   1/1  vllgllpg..plplpladlllkgvtiigslvggr...ellaellellaegllk-----------------
00397801   1/1  rlvlvGllgg..lleldllllllkeltilGsl--------------------------------------
00383791   1/1  ipvvsgagag...gqldpteillkglsvrglfvl...predleellellle-------------------
00496851   1/1  ----------------------------------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00485161   1/1  ggrvvlvnllggllltrallplllkrgkgrivns............................skaalegl
00508901   1/1  gGrvvliglls.gaplpldllplllkgltllgsllgtrllllellllll---------------------
00367461   1/1  pggvivdvgladg..eltvplllvllkgvtivgsvvl....rllleealell------------------
00450921   1/1  ----------------------------------------------------------------------
00500401   1/1  rivviGlas.gynlelpvlplllkgltllgillgsrllvldlllllelalellllllee-----------
00423661   1/1  gvvvdvaidqg..eltlplttlvlkgvtvvgsvvl....vanlpgavdllasg-----------------
00429061   1/1  rvvlvglis.gynlpllllllllkgltllgf---------------------------------------
00478461   1/1  ----------------------------------------------------------------------
00417381   1/1  ----------------------------------------------------------------------
00478471   1/1  lvlrqlilavrkgGtvsivGvyvglldgaldeaakegslklplGaafnkgl-------------------
00445261   1/1  vdlgaltgg-------------------------------------------------------------
00484541   1/1  alaaleagkhvvvekptaltveeavvplvelvelaeekgvvlgvgfgvr---------------------
00374371   1/1  gippataplllteellelmkpgg-----------------------------------------------
00484901   1/1  vLDiGcGt.GglalalakllgpdarvtgvDispealelArenakrlglddnv------------------
00496861   1/1  rvnv------------------------------------------------------------------
00528371   1/1  dvssgkpittealaeal..gervigahpvsggevgapegaladlfegplviltpmag-------------
00421801   1/1  lkpggvvvdvayppllttallplara..rglgrivdglsmlvlqgapg..felytgskaavevit-----
00472761   1/1  ----------------------------------------------------------------------
00423401   1/1  vtrellelmkpgsvivdv----------------------------------------------------
00475801   1/1  GGrlvlvvgtleg..............................leellellkeagfevvevid-------
00467441   1/1  spealelarenaaglpn.vefivgDaedplpdlleegsfDlvvsd..lphvpdpealleeaarlL-----
00484691   1/1  kpggvvvdvgy...pplitpllala---------------------------------------------
00518231   1/1  gelyenglrflvdpdgfgtglfptqellaelllelld..pgkrvLDlGcGt.Gglalala.klgagrv--
00496711   1/1  glpnrvefvvgDaedl.....dgsf---------------------------------------------
00518851   1/1  pgkrvLDlGcG.tGglalalakrgpdarvtgvDispealelarenlaenglaldd....pnvefiv----
00499151   1/1  ----------------------------------------------------------------------
00415801   1/1  lkpgkrvLDlGcG.sGllaialak.lgaakvtgvDispeale----------------------------
00446051   1/1  ----------------------------------------------------------------------
00479191   1/1  gDaedl...-------------------------------------------------------------
00528071   1/1  fDlv------------------------------------------------------------------
00491221   1/1  nvefivgDaed.l.plpellledgsfDlvvsnfavlhhlptgrrdpedleallrelarvLkPGGrlvlst
00466961   1/1  ----------------------------------------------------------------------
00473291   1/1  Gt.GaltlalaravgpggrvvavDispealelarenlara.......glalpdnvevv------------
00425341   1/1  llkrgdllvtnasilvdiiealakla.p------------------------------------------
00355351   1/1  llkpga.ivvdlstglvgtieallaall------------------------------------------
00413261   1/1  sallehlddleelleeaarlLkpgGrlvlstplptq..............................----
00469311   1/1  pd..fDlvvsnPpggvlhhlpdle----------------------------------------------
00495321   1/1  pgkrvLDlGcGt.Gglalalakllpga.rvtgvDispealelarenaalngl.dnvefvqg---------
00484381   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00367432   2/2  -------------------------------------gdlpklvdlylagklkldelithtlpleeinea
00502341   1/1  pdpeallrelarvLkPGGrlvlstpnlpdlellrlllalllrll..........................
00484141   1/1  llgkvDivinaaglge.paklldllvellervksgnvlgdlllapevlplleeasekgirvvtg------
00460591   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00502691   1/1  vssglpvdtealaaalaeggilvaglpvfgge--------------------------------------
00468381   1/1  .rvtgvDi.pemlelarerpnvefvvgDaedplp.....sfDlvvsngvlhhlpdpeleallrelarvLk
00478511   1/1  ----------------------------------------------------------------------
00472781   1/1  tgaprlp---------------------------------------------------------------
00501541   1/1  dlpfpdgsfDlvvsnavlhhlpdedleallrelarvLkPGGrlvlstpnrp.....d-------------
00479231   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00511431   1/1  relarvLkPGGrlvlst...........................pnrpdleelrelldllerlllpgh..
00518841   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00490741   1/1  rvtgvDi.pemlelarenaaelglspnve-----------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00463541   1/1  pGGrlvlstilleg..............................leellelleeagfevve---------
00511031   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00473861   1/1  aedlplpdfDlvvsnavlhhlpdp----------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00487741   1/1  lvldraalhalpp---------------------------------------------------------
00382672   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ADSASGEVIKPIITFP------------------------------------------------------
00463141   1/1  ----------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00462521   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00408171   1/1  ----------------------------------------------------------------------
00461131   1/1  tgpledinealellk-------------------------------------------------------
00481071   1/1  ----------------------------------------------------------------------
00462531   1/1  ----------------------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00461141   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00476541   1/1  ----------------------------------------------------------------------
00486731   1/1  ----------------------------------------------------------------------
00367431   1/2  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00476551   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00502031   1/1  ----------------------------------------------------------------------
00423651   1/1  ----------------------------------------------------------------------
00479941   1/1  ----------------------------------------------------------------------
00512641   1/1  ----------------------------------------------------------------------
00502041   1/1  ----------------------------------------------------------------------
00488631   1/1  ----------------------------------------------------------------------
00471041   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00385671   1/1  ----------------------------------------------------------------------
00382671   1/2  ----------------------------------------------------------------------
00512631   1/1  ----------------------------------------------------------------------
00487991   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00508891   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00387111   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00496851   1/1  ----------------------------------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00485161   1/1  tealalelagkgi---------------------------------------------------------
00508901   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00450921   1/1  ----------------------------------------------------------------------
00500401   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00478461   1/1  ----------------------------------------------------------------------
00417381   1/1  ----------------------------------------------------------------------
00478471   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00446051   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00491221   1/1  pnp-------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00367432   2/2  fellleGksirsvll-------------------------------------------------------
00502341   1/1  ...-------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00460591   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00468381   1/1  PGG-------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00511431   1/1  grf-------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00487741   1/1  ----------------------------------------------------------------------
00382672   2/2  ----------------------------------------------------------------------