[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55454.1


[Show Plain Result]

## Summary of Sequence Search
   1::335
  20::156  2.3e-33 37.2% 0041738 00417381 1/1   -like                                   
 124::306  1.7e-32 31.3% 0050040 00500401 1/1   )-binding Rossmann-fold domains         
 125::300  1.4e-31 37.4% 0050890 00508901 1/1   )-binding Rossmann-fold domains         
 125::325  2.2e-31 34.3% 0050204 00502041 1/1   )-binding Rossmann-fold domains         
   6::163  3.8e-29 30.7% 0050889 00508891 1/1   -like                                   
 125::331  2.4e-28 30.5% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
 128::311  4.3e-28 29.4% 0048799 00487991 1/1   )-binding Rossmann-fold domains         
 125::301  2.4e-26 34.5% 0051264 00512641 1/1   )-binding Rossmann-fold domains         
 125::309  1.2e-25 32.9% 0047481 00474811 1/1   )-binding Rossmann-fold domains         
 125::296  4.9e-23 33.7% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
   7::174  6.2e-23 31.1% 0047654 00476541 1/1   -like                                   
   6::175  8.1e-23 27.8% 0049685 00496851 1/1   -like                                   
 125::303  1.4e-22 34.1% 0050203 00502031 1/1   )-binding Rossmann-fold domains         
   1::164  3.6e-22 27.8% 0048862 00488621 1/1   -like                                   
   7::163  1.1e-21 31.3% 0047480 00474801 1/1   -like                                   
   7::165  1.1e-21 29.2% 0051263 00512631 1/1   -like                                   
 150::278  1.6e-21 34.6% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
 125::296  1.7e-21 33.1% 0051327 00513271 1/1   )-binding Rossmann-fold domains         
   7::163  1.8e-20 26.5% 0043275 00432751 1/1   -like                                   
 126::297  2.9e-20 30.4% 0048673 00486731 1/1   )-binding Rossmann-fold domains         
   7::137  4.6e-20 31.7% 0047994 00479941 1/1   -like                                   
 125::297  1.1e-19 31.3% 0047655 00476551 1/1   )-binding Rossmann-fold domains         
 125::325    2e-19 31.2% 0046725 00467251 1/1   )-binding Rossmann-fold domains         
   7::196  3.4e-19 30.8% 0046724 00467241 1/1   -like                                   
 125::325  4.5e-19 28.2% 0048107 00481071 1/1   )-binding Rossmann-fold domains         
   7::163  2.8e-18 26.5% 0040817 00408171 1/1   -like                                   
 124::298  3.5e-18 30.6% 0046253 00462531 1/1   )-binding Rossmann-fold domains         
 125::296  1.6e-17 33.3% 0048863 00488631 1/1   )-binding Rossmann-fold domains         
   1::173  2.1e-17 31.2% 0048672 00486721 1/1   -like                                   
 136::283  5.2e-17 29.9% 0038711 00387111 1/1   )-binding Rossmann-fold domains         
   7::163  5.5e-17 28.4% 0039779 00397791 1/1   -like                                   
   7::152  1.5e-16 30.1% 0050202 00502021 1/1   -like                                   
  18::144  2.7e-15 28.0% 0050001 00500011 1/1   -like                                   
 128::297  3.2e-15 29.3% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
   7::334    4e-15 28.1% 0046113 00461131 1/1   -like                                   
 137::298  7.8e-15 30.3% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
 125::300  1.1e-14 29.0% 0046114 00461141 1/1   )-binding Rossmann-fold domains         
   7::170  1.2e-14 27.5% 0042365 00423651 1/1   -like                                   
   7::161  1.4e-13 28.0% 0042905 00429051 1/1   -like                                   
 135::281  5.5e-13 27.1% 0036744 00367441 1/1   )-binding Rossmann-fold domains         
 128::325  8.4e-13 25.9% 0038567 00385671 1/1   )-binding Rossmann-fold domains         
 122::296  9.3e-13 28.7% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
 133::256  8.6e-12 28.5% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
 139::276  5.2e-11 29.1% 0039780 00397801 1/1   )-binding Rossmann-fold domains         
 129::298  7.4e-11 28.5% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
   8::162  9.5e-08 27.4% 0047104 00471041 1/1   -like                                   
 144::272  2.1e-07 29.2% 0048469 00484691 1/1   )-binding Rossmann-fold domains         
 122::284  2.2e-07 23.2% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
 144::273  6.6e-07 27.3% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   7::175  7.2e-07 21.7% 0038267 00382671 1/1   -like                                   
   7::178  8.7e-07 25.5% 0045092 00450921 1/1   -like                                   
 125::304  1.2e-06 20.2% 0047059 00470591 1/1   )-binding Rossmann-fold domains         
 158::245  1.5e-06 24.4% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
 156::213  7.3e-06 31.9% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
 134::197  1.3e-05 30.2% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
 156::296  1.9e-05 20.7% 0044526 00445261 1/1   )-binding Rossmann-fold domains         
 157::242    3e-05 25.0% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
 150::213  3.4e-05 22.2% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
 157::242  3.6e-05 26.6% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
 156::197  4.5e-05 36.6% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
 144::202  4.8e-05 36.8% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
  19::168  6.7e-05 28.3% 0046449 00464491 1/1   -like                                   
 156::202  6.8e-05 31.9% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
 155::197  6.9e-05 35.7% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
 159::202  8.8e-05 36.4% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
 159::245  9.1e-05 22.6% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
 155::197   0.0001 32.6% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
 156::213   0.0001 31.6% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
 155::197  0.00011 35.7% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
 159::242  0.00012 27.3% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
 155::202  0.00016 34.0% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
 120::195  0.00017 32.0% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
 158::242  0.00017 25.0% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
 159::197  0.00017 39.5% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
 152::197  0.00019 33.3% 0038545 00385451 1/1   )-binding Rossmann-fold domains         
 152::213   0.0002 23.0% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
 152::197  0.00021 33.3% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
 155::231  0.00021 26.3% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
 154::195  0.00027 31.7% 0051109 00511091 1/1   )-binding Rossmann-fold domains         
 150::195  0.00028 31.0% 0051260 00512601 1/1   )-binding Rossmann-fold domains         
 139::199  0.00029 30.0% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
 159::202  0.00029 36.4% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
 152::195  0.00031 27.9% 0038814 00388141 1/1   )-binding Rossmann-fold domains         
 155::195  0.00031 31.7% 0047681 00476811 1/1   )-binding Rossmann-fold domains         
 159::197  0.00031 42.1% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
 150::195  0.00039 26.7% 0038342 00383421 1/1   )-binding Rossmann-fold domains         
 144::213   0.0004 32.8% 0048455 00484551 1/1   )-binding Rossmann-fold domains         
 153::195  0.00042 28.6% 0036806 00368061 1/1   )-binding Rossmann-fold domains         
 152::195  0.00043 27.9% 0039871 00398711 1/1   )-binding Rossmann-fold domains         
 159::242  0.00046 25.0% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
 152::197  0.00048 31.0% 0051702 00517021 1/1   )-binding Rossmann-fold domains         
 155::245  0.00051 24.4% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
 156::195  0.00052 33.3% 0038068 00380681 1/1   )-binding Rossmann-fold domains         
 157::195  0.00052 36.8% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
 151::197  0.00055 30.4% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
 155::197  0.00055 34.1% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
 158::204  0.00056 37.0% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
 151::213  0.00061 25.8% 0039438 00394381 1/1   )-binding Rossmann-fold domains         
 151::197  0.00063 28.3% 0035018 00350181 1/1   )-binding Rossmann-fold domains         
 155::195  0.00064 32.5% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
 151::197  0.00066 28.3% 0040910 00409101 1/1   )-binding Rossmann-fold domains         
 152::195  0.00068 27.9% 0043678 00436781 1/1   )-binding Rossmann-fold domains         
 156::242  0.00069 24.4% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
 152::195  0.00088 30.2% 0043703 00437031 1/1   )-binding Rossmann-fold domains         
 157::213  0.00091 36.8% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
 152::195  0.00092 30.2% 0051568 00515681 1/1   )-binding Rossmann-fold domains         
 150::195  0.00098 28.6% 0038042 00380421 1/1   )-binding Rossmann-fold domains         
 152::197    0.001 31.0% 0049942 00499421 1/1   )-binding Rossmann-fold domains         
   1::335


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFSEGPINSVVLTQDEDGNFSTAYQDTYSDPSFLGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIP
00417381   1/1  -------------------mkalvldelggpevlelvelplpelgpgevlvkvhaaglnykDllartgly
00500401   1/1  ----------------------------------------------------------------------
00508901   1/1  ----------------------------------------------------------------------
00502041   1/1  ----------------------------------------------------------------------
00508891   1/1  -----petmkalvltgpggpevleleevplpe.pgpgevlvkvlaaglnpsDllillglyplvlplplvl
00485161   1/1  ----------------------------------------------------------------------
00487991   1/1  ----------------------------------------------------------------------
00512641   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00476541   1/1  ------Mkalvltgpgd.....leleevplpe.pgpgevlvkvlaagingsDlhlirlglyplll..plv
00496851   1/1  -----sktmkalvltgpgdpevleleevplpe.pgpgevlvkvlaaglnpsDllilrglyplvvplplvl
00502031   1/1  ----------------------------------------------------------------------
00488621   1/1  ltlsllmkamkalvlggpg..pleleevpvpep.gpgevlvkvlaagingsDlhirrglypvp.klplvl
00474801   1/1  ------mkalvltgpgdp.....leleevplpepgpgevlvkvlaaglngsDllillglyplllelplvl
00512631   1/1  ------etmkalvltgpggpevlelelevplpe.pgpgevlvkvlaaglnpsDllilsglyplvpplplv
00429061   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00432751   1/1  ------mkAlvltgpgdp....leleevpvpep.gpgevlvkvlaagicgtDlhiyrgglpllvklplvl
00486731   1/1  ----------------------------------------------------------------------
00479941   1/1  ------smpltmkalvltgpgdp....leleevplpep.gpgevlvkvlaagingsDlhillglyplplk
00476551   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00467241   1/1  ------mstmkalvltgpgdp....leleevpvpep.gpgeVlvkvlaagingsDlhilrglypv..plp
00481071   1/1  ----------------------------------------------------------------------
00408171   1/1  ------lslvitmkAavltgpggp....leleevpvpep.gpgeVlvkvlaagicgtDlhilrglypl.v
00462531   1/1  ----------------------------------------------------------------------
00488631   1/1  ----------------------------------------------------------------------
00486721   1/1  mtlslpltmkalvltgpgdp..leleevpvpep.gpgeVlvkvlaagicgsDlhilrglyp.vp.lplvl
00387111   1/1  ----------------------------------------------------------------------
00397791   1/1  ------mkAavltgpgdp....leleevpvpep.gpgeVlvkvlaagicgsDlhilrglyplllllllll
00502021   1/1  ------lpltmkalvltgpgdp....leleevpvpep.gpgeVlvkvlaagingsDlhirrglypvlp.l
00500011   1/1  -----------------mkaavvlggpgpleleevplpep.gpgevlvkvlaagicgsDlhilrglyp.l
00432761   1/1  ----------------------------------------------------------------------
00461131   1/1  ------lllslpltmkaavltgpggp....leleevpvpep.gpgevlvkvlaagicgsDllhirrglyp
00367461   1/1  ----------------------------------------------------------------------
00461141   1/1  ----------------------------------------------------------------------
00423651   1/1  ------aaalpltmkalvltgpg.....pleleevpvpep.gpgevlvkvlatgicgtDlhilkgglpla
00429051   1/1  ------mkAlvlygagdp..evlrleevplpep.gpgevlvkvkavgingtDlkilsggyp.vlklplil
00367441   1/1  ----------------------------------------------------------------------
00385671   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00471041   1/1  -------kAavllgpgdp....lrledvpvpelpgpgevlvkvaaagiCgtDlhilegllpglllvklPl
00484691   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00382671   1/1  ------lilmkAvvvlatgdPkevlflkveeiplpal.gpgevlvkviaagicgtDlailqgvyptkpvk
00450921   1/1  ------mkallllglgk.....lellevpePep.gPgevlvrtlavgvcgtDlhvldgdlpg.velgiil
00470591   1/1  ----------------------------------------------------------------------
00371281   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00482931   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00495191   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00464491   1/1  ------------------kmkAlvllgpgdlrleevpvpep.gpgevlvkvaatgiCgsDlhlykhgdlg
00502281   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00527441   1/1  ----------------------------------------------------------------------
00465741   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00514911   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00468971   1/1  ----------------------------------------------------------------------
00490261   1/1  ----------------------------------------------------------------------
00385451   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00511091   1/1  ----------------------------------------------------------------------
00512601   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00476811   1/1  ----------------------------------------------------------------------
00462911   1/1  ----------------------------------------------------------------------
00383421   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00368061   1/1  ----------------------------------------------------------------------
00398711   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00517021   1/1  ----------------------------------------------------------------------
00421311   1/1  ----------------------------------------------------------------------
00380681   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00394381   1/1  ----------------------------------------------------------------------
00350181   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00409101   1/1  ----------------------------------------------------------------------
00436781   1/1  ----------------------------------------------------------------------
00383241   1/1  ----------------------------------------------------------------------
00437031   1/1  ----------------------------------------------------------------------
00433371   1/1  ----------------------------------------------------------------------
00515681   1/1  ----------------------------------------------------------------------
00380421   1/1  ----------------------------------------------------------------------
00499421   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVGALGTAGFTA
00417381   1/1  pvvpglplvpGlefaGvvvavgeggfkvGdrVvalglglgetldGglaeyvvvpadllvplPdglsleeA
00500401   1/1  -----------------------------------------------------glsleeaAalglaglTA
00508901   1/1  ------------------------------------------------------lsleeaAalplaglTA
00502041   1/1  ------------------------------------------------------lsleeaaalplaglTA
00508891   1/1  gheaaGvVvevgsggfkvGdrVvvlllvlgllldGgfaeyvvvpadllvklPdg.sleeaaavlplagl.
00485161   1/1  ------------------------------------------------------lsleeaAalplaglta
00487991   1/1  ---------------------------------------------------------eeAAalplaglta
00512641   1/1  ------------------------------------------------------lsleeaAalplagltA
00474811   1/1  ------------------------------------------------------lsleeaAalplagltA
00405511   1/1  ------------------------------------------------------lsleeaaallcaglta
00476541   1/1  lGhEaaGvVvevGsgvtgfkvGdrVvvlpvlscgeceaclsglenlcenllfglllgllldGgfaeyvvv
00496851   1/1  GhegaGvVvevgsggfkvGdrVvvlplvlgllrdGgfaeyvvvpadllvklPdglsleeaa.........
00502031   1/1  ------------------------------------------------------lsleeaAalpeaglta
00488621   1/1  GhEaaGvVvevGsgvdtgfkvGdrVvvlplvpscgeceaclsglenlcenllllllgllllgltldGgfa
00474801   1/1  GhEaaGvVv.........GdrVvvll......ldggfaeyvvvpadllvklPdglsleeaaalplalglt
00512631   1/1  lghegaGvVvevGsgvtgfkvGdrVvvllll.....dggfaeyvvvpadllvklpdgllsleeaaalpl.
00429061   1/1  ----------------------------------------------------------------------
00513271   1/1  ------------------------------------------------------lsleeaAalpeallta
00432751   1/1  GhEaaGvVvevGsgvtglkvGdrVvvlplliscgecryclsglpnlcenllflgvlldGgfaeyvvvpaa
00486731   1/1  -------------------------------------------------------pleeaaallcallta
00479941   1/1  lplvlGhEgaGvVvevGsgvtgfkvGdrVvvlplvgscgeceaclsglenlcenllllgllldGgfa---
00476551   1/1  ------------------------------------------------------lsleeaaalpepllta
00467251   1/1  ------------------------------------------------------lsleeaaalleallta
00467241   1/1  lvlGhEgaGvVvevGsgvtgfkvGDrVvglfiscgeceaclaglenlcenllllglggdlldgtlllsll
00481071   1/1  ------------------------------------------------------lpleeaaallcpllta
00408171   1/1  klplvlGhEaaGvVvevGsgvtgfkvGdrVvvlpliscgeCraclsgrpnlcenlrllnlkgllldgtlr
00462531   1/1  -----------------------------------------------------glsleeaalllcallta
00488631   1/1  ------------------------------------------------------lsleeaAallcaglta
00486721   1/1  GhEgaGvVvevGsgvtgfkvGDrVvvlflvscgeceaclsglenlcenlvlglggglllggttrlllggk
00387111   1/1  -----------------------------------------------------------------pgltA
00397791   1/1  vklplvlGhEaaGvVvevGsgvtgfkvGdrVvvlpllscgecraclsglenlcenllflgllldggfaey
00502021   1/1  plvlGhEgaGvVvevlGsgvtgdlslfkvGdrVvglpviscgeceacllsglenlcpnllllglngglll
00500011   1/1  lklplvlGhEaaGvVvavGsgvtglkvGdrVvvlplviscgeceacrsglenlcenllllglagllllgl
00432761   1/1  ---------------------------------------------------------lplelaaalglal
00461131   1/1  ..lplPlvlGhEgaGvVvevGsgvtgfkvGdrVvvlpviscgeceaclsglenlcenllvlglagllldg
00367461   1/1  ------------------------------------------------------------------lell
00461141   1/1  ------------------------------------------------------lpleeaaallcalata
00423651   1/1  lvlklplvlGhEavGvVvevGsgvtglkvGdrVvvlpllscgecpyclagrynlcegllflgvlgldGgf
00429051   1/1  GhEaaGvVeevGsgvtglkvGDrVvvll.....cgdgglaeyvvvdedllvklPeslsllevleaaallv
00367441   1/1  ----------------------------------------------------------------llglaf
00385671   1/1  ---------------------------------------------------------lplellallGcgl
00383791   1/1  ---------------------------------------------------pkdvdlrvllllpeiglta
00496861   1/1  --------------------------------------------------------------Aasilllg
00397801   1/1  --------------------------------------------------------------------Ca
00423661   1/1  ----------------------------------------------------------lplelgalvltl
00471041   1/1  vlGhEiaGvveevGegvtglkvGdrvvvllllscgtCraCraglenlCenllllGllldGgfaeyvvvpa
00484691   1/1  ----------------------------------------------------------------------
00374371   1/1  ---------------------------------------------------agrlavleaalllervltg
00421801   1/1  ----------------------------------------------------------------------
00382671   1/1  tignptgelpvvlGhEavgvViavGsnVsslkpGDrVvpivvs.....dgalaeyavvdenaliklpdel
00450921   1/1  GheivGeVvevGsnveglkvGdrVvvpallscgtclycrrgllnlcddlllgellglgrdGafaeyvlvp
00470591   1/1  ------------------------------------------------------ldllqaatllvnPltA
00371281   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00480351   1/1  ---------------------------------------------------------------gllldta
00445261   1/1  ----------------------------------------------------------------------
00482931   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00495191   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00464491   1/1  dllvklPlvlGHEiaGvVvevGsgvtglkvGdrVvveplvscgeceycrrgrynlcenllflglppldGg
00502281   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00527441   1/1  ----------------------------------------------------------------------
00465741   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00514911   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00352901   1/1  -------------------------------------------------fgalnlgrlllgllglvpctp
00468971   1/1  ----------------------------------------------------------------------
00490261   1/1  ----------------------------------------------------------------------
00385451   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00511091   1/1  ----------------------------------------------------------------------
00512601   1/1  ----------------------------------------------------------------------
00484141   1/1  --------------------------------------------------------------------dy
00519911   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00476811   1/1  ----------------------------------------------------------------------
00462911   1/1  ----------------------------------------------------------------------
00383421   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00368061   1/1  ----------------------------------------------------------------------
00398711   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00517021   1/1  ----------------------------------------------------------------------
00421311   1/1  ----------------------------------------------------------------------
00380681   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00394381   1/1  ----------------------------------------------------------------------
00350181   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00409101   1/1  ----------------------------------------------------------------------
00436781   1/1  ----------------------------------------------------------------------
00383241   1/1  ----------------------------------------------------------------------
00437031   1/1  ----------------------------------------------------------------------
00433371   1/1  ----------------------------------------------------------------------
00515681   1/1  ----------------------------------------------------------------------
00380421   1/1  ----------------------------------------------------------------------
00499421   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ALSVNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAE
00417381   1/1  aalptaglTAylaLva------------------------------------------------------
00500401   1/1  ylallelakl...kpgetvlvhgAaGgvGsaaiqlakalGa.rviatagsdeklellkelGadhvinyke
00508901   1/1  ylalfalleraglkpge.tvlvtGAaGgvGslavqlAkalGa.rViatagseeklellrelGadevidyk
00502041   1/1  ylallelaglklspge.tvlvhGAaGgVGllavqlAkalGasrViatagseeklellvkelGadevinyk
00508891   1/1  ....ylallralggllk.getvl-----------------------------------------------
00485161   1/1  ylallllldlagllpgktvlvtGAaggiGsaaaqllaalGa.rViavdrseeklellkelgadvvidvtd
00487991   1/1  yl...alveraglkpgetVlvtgaaGgvGlaavqlAkalGa.rviatagseeklelakelGadhvinykd
00512641   1/1  ylalv..elaglkpge.tVlvhGAaGgvGlaavqlAkalGa.rViatagseeklelakelGadhvidyrd
00474811   1/1  ylalv...raglkpgd.tVlvtGAaGgvGlaavqlakalGa.rViatdrspeklelakelGadhvidyrd
00405511   1/1  yhallr...agllpgk.tvlvtGa.GgvGlaaaqlaaalGa.rViavdrseeklelarelgadvvidvtd
00476541   1/1  plaadllvklPldglslee...llcagltaylll------------------------------------
00496851   1/1  ...........................Vaiqlaka-----------------------------------
00502031   1/1  yhalv..eraglkpgd.tVlvlGa.GgvGllavqlakalGasrViatdrspeklelakelGadhvinykd
00488621   1/1  eyvvvpadllvklPdglsleeaal----------------------------------------------
00474801   1/1  aylallelaglkp......vlvl-----------------------------------------------
00512631   1/1  ...............agllkpgetv---------------------------------------------
00429061   1/1  ---------aklkpgk.tvlvtGAaggvGlaaaqlakalGa.rViatarseeklellkelGadvvidykd
00513271   1/1  yhalvr...aglkpgd.tVlviGa.GgvGllaiqlakalGagrViatdispeklelakelGadhvinyrd
00432751   1/1  nlvklpdglslelaalleplavt-----------------------------------------------
00486731   1/1  yhalvrrag..vkpgd.tVlvlGa.GgvGllavqlAkalGasrViavdlseeklelakelGadevinykd
00479941   1/1  ----------------------------------------------------------------------
00476551   1/1  yhal...rlagvkpgd.tVlvlGa.GgvGllavqlAkalGasrViavdgspeklelakelGadhvinykd
00467251   1/1  yhalvrrag..vkpgd.tVlvlGa.GgvGllaiqlAkalgasrViavdlseeklelakelGadhvinykd
00467241   1/1  glslllglllglGgfaeyvvvpadllvkllPdglsleea.................--------------
00481071   1/1  yhallrrag..vkpgd.tVlvlGa.GgvGllavqlAkalGasrviavdlsdeklelakelGadhvinykd
00408171   1/1  lslgglllggvlldggfaeyvvv-----------------------------------------------
00462531   1/1  yhalvrrag..vkpgd.tVlvlGa.GgvGllavqlAkalGasrViavdlseeklelakelGadhvinykd
00488631   1/1  yhalv...ragvkpgd.tVlviGa.GgvGllavqlAkalGa.rViavdrseeklelakelGadhvidyke
00486721   1/1  pllgflgdGgfaeyvvvpernlvkidPdglsle-------------------------------------
00387111   1/1  yvgll..eiakvkpge.tVlvlGa.GgvGllavqlaklaGagrviavdgsdeklelakelGadavvnykd
00397791   1/1  vvvpaallvklpdglsleeaall-----------------------------------------------
00502021   1/1  gllldGgfaeyv----------------------------------------------------------
00500011   1/1  lldG------------------------------------------------------------------
00432761   1/1  ltavlavlaagvkpgk.tvlvlGa.GgvGlaaaqlakalGa.kVvavdiseeklelakelGadfvvvykd
00461131   1/1  tlrlllggkslltldGlsgfaeyvvvparllvkilPdglslee...........................
00367461   1/1  svalhallragl.vpGktVlviGa.GgiGlaaalaakalGa.kViatdrspekleqakelgadfvvvykd
00461141   1/1  yhalvrrag..vkpgd.tVlvlGa.GgvGllavqlAkalgasrviavdlspeklelakelGadhvinpkd
00423651   1/1  aeyvvvpaanlvklpdglsleeaallepla----------------------------------------
00429051   1/1  alltaysalrr...aglkpge-------------------------------------------------
00367441   1/1  gtgfllllelagvlpgktVlvfGl.GgvGlaaillakaaGagrviavdlndeklelakslGadlvvnpkd
00385671   1/1  ltaliglvevaklkpGktvlvlGl.GgvGllalllakaaGagrvigvdindeklelakelGathvvnyke
00383791   1/1  lealkrallelkpgs..rVlviGa.GgvGsaaaqllaaaGvgkvilvDrdeealerarrlgpdvvvdpie
00496861   1/1  ltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrGy.kViaidrseekleklkelgadvvldvtd
00397801   1/1  ltvayaalkraglkpgdtvlvvGaaGgvGllavqlakalgaarviavdlsdeklelakelgadhvinske
00423661   1/1  atavralllagvlp.gakVlvlGa.GvvGlqaaalakalGageVtvvDisperleqaeelGadlvvvpse
00471041   1/1  rllvklpdglldleeaalllea------------------------------------------------
00484691   1/1  ---vsllkrlgvdlpgkrvlviGa.Ggagraaalallalga.evtvvnrtlekaeelaelladevvaldl
00374371   1/1  lgal......agllpgkrvlViGa.GgiGleaAaalarlGa.kVtvvdrrpellerleelgakfvlltld
00421801   1/1  ---DgigavsllkrllvdlpgkkvlvlGa.GgiGralalalaaaga.evvvvnrtlekaeelaeelgaqg
00382671   1/1  .aalltlaaltalkaireletlydlllsl.grlvl-----------------------------------
00450921   1/1  aadaflvklPdelddeaaalleplsvt...alrslvkr--------------------------------
00470591   1/1  yllltdfv..dlkpGndwviqnaansavGklviqlakllGlktinvvrdrpdleelvdeLkalGadvvit
00371281   1/1  -----------------kvlVTGgaGfiGsalvraLlerGyeevvvldrlesgakl..........gpgv
00464721   1/1  ---------------MgktvlvtGatGfiGsalaraLlarGaveVvaldrspe...........Dltdpe
00480351   1/1  llvllllllllldlkgkvalVtGasggiGlaiAralaaaGa.rVvladrneekleal-------------
00445261   1/1  ---------------pkslpllelallltglltawlplllagllpgktvgviGl.GgiGlavarlakalG
00482931   1/1  ----------------nktvlvTGatGgiGsalaraLlarGa.eVvlldrlssgaseekleelaaelraa
00424291   1/1  ---------mmlslkgkvvlvtGasggiGralaralaaaGa.rVvlldrseekleelaaelgrvlavvlD
00495191   1/1  ----------------rktvlvTGatGgiGsalaraLlarGa.eVvlldrlssglspekleellaellea
00460341   1/1  ---------------gktvlvTGatGgiGsalaraLlarpGae.Vvaldrltsagsp-------------
00423401   1/1  ---aGylavllaalllcrflgglgllltlagglagkkvlviGa.GgvGlaaarllaalGa.k--------
00464491   1/1  faeyvvvpaallvklPdglslel..aal------------------------------------------
00502281   1/1  ---------------mmkvlitGAtGfiGselvrlLlehgdhevtaldrrtsagkllnepgv--------
00493571   1/1  --------------llsllsslldllslkgktvlvTGatGgiGsalaraLlarGa.e-------------
00527221   1/1  ------------------llllkillslkgkkvlvtGAtGgiGralvkellargavskvial--------
00511831   1/1  ------------------llllmmmslegktvLVTGAtGfiGsalvrrLlerG.yeVvaldrspekleel
00527441   1/1  --------------amdlgllsgkvvlvTGasggiGralaralaarGarvVvlldrs-------------
00465741   1/1  ---------------MgktvlvTGatGgiGsalaraLlarGa.eVvlldrspsslllllekleelaaele
00507211   1/1  --------------ldmmslmgktvlvTGatGgiGsalaraLlarGa.eVvlldrsp-------------
00514911   1/1  ------------------SKtvlvTGatGgiGsalaraLlerGa.eVvlldrspekleellaeleallgg
00532871   1/1  --------------lsgktvlVtGAtGgiGsalvrrLleagdvaevvalvrspekleelgg.--------
00352901   1/1  lgilellerlgidlsgkvalVtGasggiGraiallLaraGat.Vtvtdrntenle---------------
00468971   1/1  -----------------ktvlvTGatGgiGsalaraLlarpGa.eVvaldrlsspeklealaallgal..
00490261   1/1  ------------------ktvlvTGatGgiGsalaraLlarGa.eVvaldrspekle-------------
00385451   1/1  -----------ldlkgkvalvTGasggiGlaiAralaaaGa.rVvlldrseekleel-------------
00361941   1/1  -----------mdlkgkvalvtGasggiGraiaralaaaGa.rVvlldrneekleelaaelgrvlavvlD
00354711   1/1  -----------MslkgkvvlvTGasggiGralaralaaaGar.Vvlldrseekleel-------------
00385591   1/1  --------------egkvvLVtGgsggiGraiaralaaaGa.rVvvvdrseealgggvlavaaDvtdeea
00511091   1/1  -------------sslsllldmlslkgkvalvTGasggiGralaralaarGa.rV---------------
00512601   1/1  ---------sdmslkgkvalvTGasggiGlalAralaarGar.Vvlldrseekle---------------
00484141   1/1  iglvnllkklgldlkgktvliiGa.GgvGlaiaqalaalGakkVvlvdrdeekaqalve-----------
00519911   1/1  ------------------lllllllimmmlkgkkvlvtGAtGgiGralvkeLlergavskVt--------
00388141   1/1  -----------ldlkgkvalvTGassgiGraiaralaarGa.rVvlldrseekle---------------
00476811   1/1  --------------kgkvalvTGassGiGlaiAralaaaGarlllVvltdrneek---------------
00462911   1/1  ------------------skkvLvTGatGfiGsalvrrLlerGy.eVialdrlssgs-------------
00383421   1/1  ---------pslslkgkvalvTGasgGiGralaralaarGa.rVvlldrsglssl---------------
00484551   1/1  ---vellkrlgvdlkgktvlitGA.Ggagraialalaklg..nvvianrtlekaealaeelgelggavkv
00368061   1/1  ------------dlkgkvalvTGassgiGlaiAralaaaGa.rVvlldrneekle---------------
00398711   1/1  -----------mdlkgkvalvTGassgiGraiaralaaaGa.rVvlldrneekle---------------
00400431   1/1  ------------------MgkkvLvTGgtGfiGsalvraLlerGa.evvvldrdpegaaellallealg.
00517021   1/1  -----------ldlkgkvalvtGassgiGlaiAralaaaGa.rVvlldrseekleel-------------
00421311   1/1  --------------kgkvalvTGassgiGraiAralaaeGa.rVvltdrnseekleelaaeleallggra
00380681   1/1  ---------------gkvalvTGasggiGlaiaralaaeGa.rVvlldrneekle---------------
00481861   1/1  ----------------kkvlvtGAsGgiGsalalllaarga.evvlldrspekle---------------
00387701   1/1  ----------mmdlkgkvalvTGasggiGlaiaralaaeGa.rVvlldrneekleel-------------
00367851   1/1  --------------kgkkvlviGa.GgiGralaraLaeaGa.evtvadrslekaeal-------------
00491171   1/1  -----------------ktvlvTGatGgiGsalaraLlallllslaGa.evvaldrspseeale------
00394381   1/1  ----------mmslkgkvalvTGassgiGraiaralaaaGa.rVvltdrsgeekleelaaelealggrvl
00350181   1/1  ----------mmdlkgkvalvTGassgiGlaiaralaaaGa.rVvlldrneekleel-------------
00486141   1/1  --------------kgkvvlvtGgsggiGsalaralaaeGa.kvvlvdrseeala---------------
00409101   1/1  ----------mmdlkgkvalvTGassgIGlaiaralaaeGa.rvvlldrneekleel-------------
00436781   1/1  -----------mdlkgkvalvTGassgiGlaiAralaaaGa.rVvlldrseekle---------------
00383241   1/1  ---------------MgkrvLvTGgtGfiGshlvraLlerpGh.evvvldrlpsgadallellalltlll
00437031   1/1  -----------mdlkgkvalvtGassGiGraiAralaaeGa.rVvltdrneekle---------------
00433371   1/1  ----------------ktvLVTGatGfiGsalaraLlerGyrVvaldrdpekleellaelealgggvefv
00515681   1/1  -----------mdlkgkvalvTGassgiGlaiAralaaaGar.Vvltdrneekle---------------
00380421   1/1  ---------mmlslkgkvalvTGassGiGlaiaralaaaGa.rVvlldrneekle---------------
00499421   1/1  -----------ldlkgkvalvtGassgiGlaiaralaaaGar.Vvlldrseekleel-------------


                         -         -         -         +         -         -         -:280
query           LSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTVLPFILRGVHLVGINSVD
00417381   1/1  ----------------------------------------------------------------------
00500401   1/1  edfveevleltggegvdvvldnvggetleaslkllapgGrivviGlasgynlelpvlplllkgltllgil
00508901   1/1  dlveevleltggegvdvvldtvggetleaalallapgGrvvligllsgaplpldllplllkgltllgsll
00502041   1/1  eedlvealkeltgggvdvvldtvggetleaaldalapgGrivliglasgyvleldlllllllllllllll
00508891   1/1  ----------------------------------------------------------------------
00485161   1/1  edaveal.agggvdvvvnnaggatlgallellapggrvvlvnllggllltrallplllkrgkgrivns..
00487991   1/1  edfveavleltggrgvdvvldavggetleaaldllapgGrvvlvGlasgailplpllllllkgltllgsl
00512641   1/1  edlveavkeltggrgvdvvldtvggetleaaldllapgGrlvlvgllsg..lpldllllllkgltllgsl
00474811   1/1  edl..altggggvdvvldtvgg.tleaaldllrpgGrlvlvgllsggplplpllllllkgltllgsllgs
00405511   1/1  edlveavleltggvDvvvdaagvpatleealrllkpggrlvlvgvagg.llpldlarlllkgvnlrgsfl
00476541   1/1  ----------------------------------------------------------------------
00496851   1/1  ----------------------------------------------------------------------
00502031   1/1  edlldlveavkeltggrgvdvvldavggpatleaalellrpgGrlvlvgvlsgpllllplpllllllkgl
00488621   1/1  ----------------------------------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00512631   1/1  ----------------------------------------------------------------------
00429061   1/1  edlvealkeltggrgvdvvlnnvggetldaaldllapggrvvlvglisgynlpllllllllkgltllg--
00513271   1/1  edlveavleltggrgvdvvidavggeatleaalellkpgGrivlvgvlgggnllelplpllllllkgltl
00432751   1/1  ----------------------------------------------------------------------
00486731   1/1  edkdlveavkeltgggvdvvldavggpatleqalellrpglGrvvlvGvpggplpllpllllllkgltll
00479941   1/1  ----------------------------------------------------------------------
00476551   1/1  edlveavleltggrgvdvvldavggeatleaalellrpgGrivlvgvlggglllplplpllllllkeltl
00467251   1/1  edlveavkeltgggvdvvldavggpatleaalealrpgGrlvlvGvlggplllpldllllllkeltllgs
00467241   1/1  ----------------------------------------------------------------------
00481071   1/1  ededlveavkeltgggvdvvldavggpatleaalellrpglGrivlvGvpggplpllpllllllkeltll
00408171   1/1  ----------------------------------------------------------------------
00462531   1/1  ledlveavkeltggrgvdvvidavggeatleaalelllrpgGrivlvGvpggpllplpllllllkgltil
00488631   1/1  edlvaell.gggvdvvldtvggpleltleaalellrpgGrlvlvGlp.ggplpldllllllkgltilgsl
00486721   1/1  ----------------------------------------------------------------------
00387111   1/1  ledlaealkeltggegvdvvldnvggeeallaalrlllkpgGrvvlvGvisgyvlplpllelllkrltlr
00397791   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00432761   1/1  edvaeavleltggadvvidtagipgilreilrllkpggvivllgllpg.plplpladlllkgvtiig..s
00461131   1/1  ......................................................................
00367461   1/1  lsediieavaellatngggadividtagipgileeavdllkpggvivdvgladg.eltvplllvllkgvt
00461141   1/1  ededlveavkeltgggvdvvleavgapaaleqalellrpggGrvvlvGvpgg.plplpllllllkeltll
00423651   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00367441   1/1  ldeevaeavleltgggvdvvveavgsvqallqaidavrpgwGtvvlvGllgkelelplv..lvlngltlr
00385671   1/1  tekvaeevkeltdgegvdvvieavgspqtlreaisvlkkpgGtvvlvgvpsgplellpivllvlssktvr
00383791   1/1  .dlaeallellggrgvDlvldcvdnfetlallidalkpggipvvsgagag..gqldpteillkglsvrgl
00496861   1/1  veellkallklggvdvvihtagapvtelslsllkqllrvnvlgtln------------------------
00397801   1/1  edlveevleltggrgvdvvldavgaeatlelaldllapgGrlvlvGllgg.lleldllllllkelt----
00423661   1/1  edlaeavreltgkqgggaDlvitaagipgvlrealevmkpggvvvdvaidqg.eltlplttlvlkgvtvv
00471041   1/1  ----------------------------------------------------------------------
00484691   1/1  ddleeal.....ggaDlvinatgagmaglvlplllsllkpggvvvdvgy..pplitpllala--------
00374371   1/1  eelvevvlaltvdvsdeegrlkavetleellgeaDvvivaagippataplllteellelmkpggiivdia
00421801   1/1  dvsdleeleeal.....ggaDivvnatgaglpglllelllellkpggvvvdvaypp..lltta-------
00382671   1/1  ----------------------------------------------------------------------
00450921   1/1  ----------------------------------------------------------------------
00470591   1/1  eeelldedlkkllkeltkgggeevklalnavGGksatallrlLspggllvtyGglskepvtlptsllifk
00371281   1/1  efvegDltdpesleaaleevekfggvdvvihlAai-----------------------------------
00464721   1/1  sla-------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00445261   1/1  a.rViaydrspeklelakelgadfvvvysdedsleel..lkgaDvvilhvpltlaleevlellkpggvvv
00482931   1/1  ggpgvef.vqgDltdpeslaaalagvrldvvv--------------------------------------
00424291   1/1  vtd-------------------------------------------------------------------
00495191   1/1  lgggvefvqgDltdp......eslaaalagvr--------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00511831   1/1  aallealggdpgvelvvgDltdpesleaale..gv-----------------------------------
00527441   1/1  ----------------------------------------------------------------------
00465741   1/1  alg-------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00514911   1/1  gvefvqgDlt......dpeslaaaleevgvdv--------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00468971   1/1  .gvef.vqgDltdpeslaaalagvridvvihn--------------------------------------
00490261   1/1  ----------------------------------------------------------------------
00385451   1/1  ----------------------------------------------------------------------
00361941   1/1  vtd-------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00385591   1/1  vaalvaaavellefggldvlv-------------------------------------------------
00511091   1/1  ----------------------------------------------------------------------
00512601   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00476811   1/1  ----------------------------------------------------------------------
00462911   1/1  ----------------------------------------------------------------------
00383421   1/1  ----------------------------------------------------------------------
00484551   1/1  dvl-------------------------------------------------------------------
00368061   1/1  ----------------------------------------------------------------------
00398711   1/1  ----------------------------------------------------------------------
00400431   1/1  gprvefvagDltdpealeaala..gvdaVvhl--------------------------------------
00517021   1/1  ----------------------------------------------------------------------
00421311   1/1  lavalDvtdealaeeleelelllllllesvealve-----------------------------------
00380681   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00394381   1/1  ava-------------------------------------------------------------------
00350181   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00409101   1/1  ----------------------------------------------------------------------
00436781   1/1  ----------------------------------------------------------------------
00383241   1/1  slleklllllellgprvefvegDltdpealaa--------------------------------------
00437031   1/1  ----------------------------------------------------------------------
00433371   1/1  egD-------------------------------------------------------------------
00515681   1/1  ----------------------------------------------------------------------
00380421   1/1  ----------------------------------------------------------------------
00499421   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           APRELRRRAWALLSEHLDTAVLDDMTTVIDVKDVAQAGEDLMAGKLHGRTAVRVH---------------
00417381   1/1  ----------------------------------------------------------------------
00500401   1/1  lgsrllvldlllllelalelllllle--------------------------------------------
00508901   1/1  gtrllllelllllllglllp--------------------------------------------------
00502041   1/1  kgltllgfllgslpellr.........................ea-------------------------
00508891   1/1  ----------------------------------------------------------------------
00485161   1/1  ..........................skaalegltealalelagkgigvvV-------------------
00487991   1/1  lgsrldlrellllvalgkilplvlithllel---------------------------------------
00512641   1/1  lgtlllelleelldllaegkl-------------------------------------------------
00474811   1/1  .......rlleelldllaegklkpvilit-----------------------------------------
00405511   1/1  g..traalpellella------------------------------------------------------
00476541   1/1  ----------------------------------------------------------------------
00496851   1/1  ----------------------------------------------------------------------
00502031   1/1  tlvgsllgt..redleelldlla-----------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00512631   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00513271   1/1  vgsllgt.raelleea------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00486731   1/1  gslvgsraprdlpelld-----------------------------------------------------
00479941   1/1  ----------------------------------------------------------------------
00476551   1/1  lgsllg..tredlpell-----------------------------------------------------
00467251   1/1  llggr...........................lpleelpellell-------------------------
00467241   1/1  ----------------------------------------------------------------------
00481071   1/1  gslvggr...........................lvleelpelle-------------------------
00408171   1/1  ----------------------------------------------------------------------
00462531   1/1  gslvgg.redlpelldll----------------------------------------------------
00488631   1/1  vg..sradleelldlv------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00387111   1/1  gfi-------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00432761   1/1  lvggrellaellellae-----------------------------------------------------
00461131   1/1  ......................................................----------------
00367461   1/1  ivgsvvl...rllleeal----------------------------------------------------
00461141   1/1  gslvg..grrdleellelle--------------------------------------------------
00423651   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00367441   1/1  G---------------------------------------------------------------------
00385671   1/1  gslvggr...........................vpleelpealk-------------------------
00383791   1/1  fvl..predleellel------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00423661   1/1  gsvvl..vanlpgavdll----------------------------------------------------
00471041   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00374371   1/1  svag------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00382671   1/1  ----------------------------------------------------------------------
00450921   1/1  ----------------------------------------------------------------------
00470591   1/1  dltlrGfwltkwlkedpeekldtl----------------------------------------------
00371281   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00445261   1/1  dlgaltgglinaevla------------------------------------------------------
00482931   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00495191   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00527441   1/1  ----------------------------------------------------------------------
00465741   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00514911   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00468971   1/1  ----------------------------------------------------------------------
00490261   1/1  ----------------------------------------------------------------------
00385451   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00511091   1/1  ----------------------------------------------------------------------
00512601   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00476811   1/1  ----------------------------------------------------------------------
00462911   1/1  ----------------------------------------------------------------------
00383421   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00368061   1/1  ----------------------------------------------------------------------
00398711   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00517021   1/1  ----------------------------------------------------------------------
00421311   1/1  ----------------------------------------------------------------------
00380681   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00394381   1/1  ----------------------------------------------------------------------
00350181   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00409101   1/1  ----------------------------------------------------------------------
00436781   1/1  ----------------------------------------------------------------------
00383241   1/1  ----------------------------------------------------------------------
00437031   1/1  ----------------------------------------------------------------------
00433371   1/1  ----------------------------------------------------------------------
00515681   1/1  ----------------------------------------------------------------------
00380421   1/1  ----------------------------------------------------------------------
00499421   1/1  ----------------------------------------------------------------------