[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55467.1


[Show Plain Result]

## Summary of Sequence Search
   1::282
  17::280  8.1e-29 18.0% 0049745 00497451 1/1   e isomerase-like                        
   1::279  4.9e-22 21.3% 0047759 00477591 1/1   e isomerase-like                        
   1::282  1.9e-21 22.5% 0051438 00514381 1/1   e isomerase-like                        
  16::280  8.2e-21 20.7% 0049033 00490331 1/1   e isomerase-like                        
   8::250    1e-13 16.2% 0047312 00473121 1/1   e isomerase-like                        
  16::280  2.4e-11 22.2% 0045684 00456841 1/1   e isomerase-like                        
   3::280  4.5e-11 20.2% 0045685 00456851 1/1   e isomerase-like                        
   1::279  2.7e-10 19.5% 0052817 00528171 1/1   e isomerase-like                        
   1::280  1.6e-09 19.5% 0049040 00490401 1/1   e isomerase-like                        
  15::277  1.9e-08 18.2% 0046285 00462851 1/1   e isomerase-like                        
  16::277  1.2e-06 19.9% 0052921 00529211 1/1   e isomerase-like                        
   2::282  4.6e-06 20.9% 0051053 00510531 1/1   e isomerase-like                        
   4::269  0.00023 19.0% 0053353 00533531 1/1   e isomerase-like                        
   4::250   0.0004 18.8% 0050979 00509791 1/1   e isomerase-like                        
   8::199  0.00087 16.9% 0036651 00366511 1/1   e isomerase-like                        
   1::282


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADIGVQMMMLKDQVAELGMYPVLEKLKELNIASVEVSQIPMNEENTAALERGISELGIEVGALSVAFGP
00497451   1/1  ----------------mkltfrwygpsldpvslelirqiaGvegivtalldipvgevwpleeleelkkli
00477591   1/1  mmklainlsslfnel...pllerleaaaeaGfdgvEllfpd..dldaeelkklledagLevvllnpllgl
00514381   1/1  mmklainliafgtdlvrglpllellalaaeaGfdgvElrrelflsdldlaalaellaelgLtv.llsvpl
00490331   1/1  ---------------slgktmklkisvalWtfgndgmkpfgahtfpglsleealelaaelGfdgvelfle
00473121   1/1  -------llilalltllfldlpleealeaaaeaGfdgiElflpdllllllddedaeelkalledlglkvv
00456841   1/1  ---------------seyfkdidkikyeGldsknplAfrlYnpdevvlgktleellrfsvalwhtfcwqg
00456851   1/1  --leyfkdidkikyeGpdsknplafklYnpdevvlgktleehlrfsvayWhtflwqgddpfGfgtllrpl
00528171   1/1  mpmklalatltllg....lpleealeaaaeaGfdgvelrlpdlldllldgltleelkallddhgLkvvsl
00490401   1/1  MmkiGahvsi......aggleealeeaaelGldaielflknprfwravplseedieelkelleehglklv
00462851   1/1  --------------iklegayslnplafkyynvdeevagkklkelriavayWqgddvhtfelpgdpfggg
00529211   1/1  ---------------gktmkdhmkfavntwalgnqgtdpfgfgtgrplpleeafeaaaelGfdgvelhdp
00510531   1/1  -lkiGahvsaag....glsledaleeaaelGldavelflgnprfwrgvplseedaeefkellkeygleil
00533531   1/1  ---lgktlelrfsvglWtfgwsgadrfglgtrpg......lsleealelaaelGfdgvelhdrdlapfgd
00509791   1/1  ---ktmlehlrfavnlwtfgnsgtdpfgfgtgprlpleealelaaelGldgvelhdddlapegdtlaetp
00366511   1/1  -------Mgkkmldhlrfalnlwhfgnsgtdpfgtgt...faelpleeafeaaaelGfdgvelhdedlap


                         -         -         *         -         -         -         -:140
query           SAAPGVDSLENDFDKIVADCKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNH
00497451   1/1  edlglkllviesipvsndiklglgsrdflie.dleetlelaaeaGfdgiElnfmglldadleelkalldd
00477591   1/1  lgaglnllsadperreealerlkraidlaaalgakvlvvvagllpggvdteealerlaenlreladlaae
00514381   1/1  gll..tddgelnaaleralelAqalgapvlkvlagllreg............enlrelaelaeragvrll
00490331   1/1  dlgpygalllespedlaelkalleehGlklsshnpylfghpryvlgnlaspdpevreealealkraiela
00473121   1/1  slnpllnlaspdperreealedlkraielaaelGakvlvvhpgslpggvsleealerlaeslreladlae
00456841   1/1  ddpfGfgtalrpwklgistlsfaplsleealelaaelGfdgvelhdldlapegldllepldlsdedlael
00456851   1/1  klgistlslppl....dleealelaaelGvprlcfdgvElapegpelvelpdlspedleelkellkehgl
00528171   1/1  ellrgfegdperreealerleralelaaalgaklvvvvagvdpd......rerlaenlaeladlaaeygi
00490401   1/1  sllvhapylinlaspdeekreksvealldeleraaalgakllvfhpgshlgdidreealeriaeslnell
00462851   1/1  tfargwypgdalglfealadllpleellelaaelGfdgvElapegpilrdelsdedldelkelleehglk
00529211   1/1  dlapegdslaetdedlaelkaaleetGlklvaltanlfsdprykdgaltspdpdvraraiaqlkraidla
00510531   1/1  svhapylinlaspldeekreksldalkdeieraaalgakllvvfhpgsylgagreealerlaealnelle
00533531   1/1  tlaetlenlaelkealketGlkllsltpnlfshprykdGaltspdpevrdraidhlkraleiaaelGael
00509791   1/1  anldelrdaleetglkllsltpnlfsdprykggaltspdpevrayaieqlkraidlaaeLGartlvlwgG
00366511   1/1  egaslreddadleelrealeetglkllsltanlfsdpryvlgaltspdadvraravdqvkraidlAaeLG


                         +         -         -         -         -         *         -:210
query           HVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKEYAGVCKLIHVKDFRVTELPEEAMEL
00497451   1/1  aglklvslhlslasldpeereealealkkaielagalgarvvvlhpglvprpgldeeeawerlaeflrel
00477591   1/1  hgvrlalEplnryehpgyllntlaealalleavdspnvglllDtyHaqieggdlaeairrlgdrighvhi
00514381   1/1  vEnhpttlvgtlaqllrlldavdelspnlgltfDighwawagedplealralgprigyvHlkdvlgrv..
00490331   1/1  aalGakvlvvhpGregydsllgldleealerlaealrelaelaeehGfdvrlalEnlnthphegtllstl
00473121   1/1  eygvklalEplnppgtflntleealelieavdspnvglllDtfHlfiaggdleelirllgdrighvHlkD
00456841   1/1  kellkeaGlklsslnanlfvhppyliGnlaspdpevreaaiealkraielaaalGakvlvvhpGsdgydt
00456851   1/1  klsshnpylflhprykaGnlaspdpevrekaieqlkraidlaaalGakvvvvhpGrdgydslggldreea
00528171   1/1  ..alEplpg.tvvntledalelveavgrpnvglllDtfHlarsggdladllrlpadrifhvqlkDapadv
00490401   1/1  dlae..gvtlalEntagkgselgstfeelarlidavddkprvgvclDtgHafaagydlltpedfdevlee
00462851   1/1  llshapyfshpryllglnlaspdpevreeaieqlkraidlaaalGakvllgpllvvhpgdGydp.ggldr
00529211   1/1  aeLGaetlvlwggregyevplgtdleealdrlaealrelaeyaeeigfdvrlaiEpkpfepakgsl.lnt
00510531   1/1  ..eeygvtlllEnmagkgtelgssfeelaeiidlvde.kprvgvclDtcHafaagydlvedfdevleefd
00533531   1/1  iviwggregyetlgntdreaaldrlaeflaelaeiaeeyGfdirlaiEpkpfepfggrilstvadalall
00509791   1/1  rdgydylgntdr.eealdrlaealrelaeyaeeiGvdgrlaiEpkpfepapgqfletaatalalleavgs
00366511   1/1  aetvvvwgGregyeylggtdleealerlaealrelaeyaeeigfdvrlllEpkprepag-----------


                         -         -         -         +         -         -         -:280
query           FTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFFIEQDMTYGRDPFDCIKDSREYLTSI
00497451   1/1  aelaeeaGvrlalEpldppvnhpgeprllntpedllrlleavdspnvglllDtghlgviaggdplelirk
00477591   1/1  kdv.....pg.......................rlepgdGeidfpaifraLkeigYdGwvslEyfp...-
00514381   1/1  ..................dggllvfvplgeglidwpalldal..gydgpvslEyplr.lddpladtrasl
00490331   1/1  eealrlleavgspnrvglclDtgHaalagedpleelrrlggldrighvHlkD..................
00473121   1/1  apgppgsll..................srdrrlppGeGei------------------------------
00456841   1/1  lggvdreealerlaeslrelaeyaeehGfdvrlalEnhpgepapgtllytl..eealrlleavgspnrvg
00456851   1/1  lerlaeslrelaeyaeehGvdgrlalEnhpgepapgtllstleealrlleavgspnrvglllDtgHafla
00528171   1/1  padllresrhd...............rllpGeGvidlaellraLkelgydGlpvsvEvfsdglreadpl-
00490401   1/1  fdkilgldrlkhvHlnDskgel....................gsrvdrhlpiGeGdidfeallrllkdig
00462851   1/1  eealerlaeslrelae..eehGpavkllalEphpgeptllstlee.alelleavglspnvglclDtg---
00529211   1/1  vatalalleevglpnllgvnlDtgHatlaggdpahelalagalgrlghvhlnd..............---
00510531   1/1  eilgldrikhiHlnds..............kgelgsrkdrhlnige......Geidfeallklladlgyd
00533531   1/1  eavdlpnllglclDtgHlalagedpeeilalaldagrlgsihlsdvrpl..........-----------
00509791   1/1  pnllgvnlDtgHallagedpeeeialagalgrlghvHlnd------------------------------
00366511   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GW--------------------------------------------------------------------
00497451   1/1  ----------------------------------------------------------------------
00477591   1/1  ----------------------------------------------------------------------
00514381   1/1  el--------------------------------------------------------------------
00490331   1/1  ----------------------------------------------------------------------
00473121   1/1  ----------------------------------------------------------------------
00456841   1/1  ----------------------------------------------------------------------
00456851   1/1  ----------------------------------------------------------------------
00528171   1/1  ----------------------------------------------------------------------
00490401   1/1  ----------------------------------------------------------------------
00462851   1/1  ----------------------------------------------------------------------
00529211   1/1  ----------------------------------------------------------------------
00510531   1/1  gi--------------------------------------------------------------------
00533531   1/1  ----------------------------------------------------------------------
00509791   1/1  ----------------------------------------------------------------------
00366511   1/1  ----------------------------------------------------------------------