[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55600.1


[Show Plain Result]

## Summary of Sequence Search
   1::481
   1::475  1.3e-71 26.9% 0042501 00425011 1/1   eneral substrate transporter            
   1::475  5.7e-66 25.9% 0042480 00424801 1/1   eneral substrate transporter            
   1::481


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDSQINTQTSPATAKLPREVVVVLSILVISAMIMILNETILSVALPSIMADFQVPETTAQWLTTGFMLTM
00425011   1/1  Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpalpll.edlglsaaqaglllsaff
00424801   1/1  Mkek.rrrv..............llllflgyflsgldfgligpllplilkdflglsaaqigllfsayllg


                         -         -         *         -         -         -         -:140
query           AVVIPTTGYLLDRFSTKTIFVTALLFFTVGTLTAALAPTFAVLLGARIIQAVGTALVMPLLMTVTLTVVP
00425011   1/1  lgyalgallaGplaDrfGrrrvlllglllfalgslllalaallgpslalllllrflqGlgagglfpaala
00424801   1/1  aalgsplaGrlsDrfGrrkvlllglllfalgslllafaptystslwlllllrflqGlgagglfpaalali


                         +         -         -         -         -         *         -:210
query           AERRGSMMGIISIVISVAPALGPTLSGVILNSLTWHWLFWMMLPIVAVALVIGFFLIKNIGETKITPLDV
00425011   1/1  llaewfppkergralglfgaggglGgalgpllggllleldlgWrwafliaailalllalllllllpespr
00424801   1/1  aelfppeerglaleygllsaggslGallgpllggllld.lgwrlvfliaailalllllllllflpesprf


                         -         -         -         +         -         -         -:280
query           LSVILSVFAFGGLVYGFSSFGAILEGKGVVGIVAIVVGAIALVIFALRQHQLGKQDKALMDLRAFKVRNF
00425011   1/1  flllkglseeerkvlerrlkad................................................
00424801   1/1  laakgklee.................................................ekkaslklslke


                         -         *         -         -         -         -         +:350
query           SFSLTTILLAFGAMLGTVMVLPIYLQTSLGVTALVTGLVVMPGGLLQGLISPFIGRFYDKVGPRPLLIPG
00425011   1/1  ...aeakaasplsllellrnprflllllayfllflgfyglltflplylqevlglsasqaglllalfglgg
00424801   1/1  llknprllllllavfllflgfyalltylplylqslfevlglsasqaglllalfglggilgsllagrlsdr


                         -         -         -         -         *         -         -:420
query           AIALAVAASSMTFLNENSPVWMVVVLHVIFSIGMCLMMTPLMTTALGALPKHLYGHGSAILNTFQQLAGA
00425011   1/1  ilgsllagrlsdrlpegrrrrllliglllaalgllllallpgt.slallllllfllgfglggafpllfal
00424801   1/1  lgrrrllligllllalgllllal...apslwllllllillgfgfglafpllfallselfppelrgtalgl


                         -         -         +         -         -         -         -:490
query           AGTAIMIAALSFGTSIAASSGSAHAEAVAAGTRVAFIAGAIIAVIALVVSLFVTRVEEETH---------
00425011   1/1  vaelfppelrgtasgllnlagnlggallgpllagllldat...............---------------
00424801   1/1  lnllagslggalgpllagllldal.................gysaaflllaalal---------------