[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55672.1


[Show Plain Result]

## Summary of Sequence Search
   1::455
   3::317  3.4e-59 40.3% 0048016 00480161 1/2   otide-binding domain                    
   4::317  7.5e-51 41.4% 0046156 00461561 1/2   otide-binding domain                    
 105::317    4e-48 37.0% 0036016 00360162 2/2   AD(P)-binding domain                    
 105::317  1.6e-36 34.8% 0040619 00406192 2/2   AD(P)-binding domain                    
   1::219  9.1e-34 29.4% 0052963 00529631 1/1   AD(P)-binding domain                    
   1::222  2.1e-28 28.0% 0047141 00471411 1/1   otide-binding domain                    
   3::317  6.2e-25 32.8% 0050364 00503641 1/1   AD(P)-binding domain                    
   1::183  4.2e-23 28.2% 0036459 00364591 1/1   otide-binding domain                    
   1::195  8.4e-22 28.0% 0050363 00503631 1/1   AD(P)-binding domain                    
   1::384  9.3e-22 25.4% 0037441 00374411 1/1   AD(P)-binding domain                    
   1::173  5.7e-21 28.6% 0048807 00488071 1/1   otide-binding domain                    
   1::384  1.1e-20 27.7% 0043577 00435771 1/1   AD(P)-binding domain                    
   1::391  2.6e-19 24.2% 0052600 00526001 1/1   AD(P)-binding domain                    
   1::177  1.7e-18 26.6% 0049222 00492221 1/1   AD(P)-binding domain                    
   5::393  4.6e-18 27.1% 0050927 00509271 1/1   AD(P)-binding domain                    
   3::183  5.9e-18 30.1% 0046750 00467501 1/1   AD(P)-binding domain                    
   6::101  8.2e-18 34.4% 0036016 00360161 1/2   AD(P)-binding domain                    
   2::387  1.3e-17 24.4% 0045797 00457971 1/1   AD(P)-binding domain                    
   4::399  6.3e-17 26.0% 0049990 00499901 1/1   otide-binding domain                    
   1::384  1.1e-16 24.8% 0049150 00491501 1/1   AD(P)-binding domain                    
   6::102  1.5e-16 27.8% 0040619 00406191 1/2   AD(P)-binding domain                    
   1::293  1.6e-16 23.8% 0046274 00462741 1/1   AD(P)-binding domain                    
   1::419  3.4e-16 22.6% 0052926 00529261 1/1   AD(P)-binding domain                    
   3::177  9.6e-16 23.6% 0048583 00485831 1/1   AD(P)-binding domain                    
   1::392    1e-15 25.9% 0040035 00400351 1/1   AD(P)-binding domain                    
   5::390  1.3e-15 24.2% 0045870 00458701 1/1   AD(P)-binding domain                    
   1::173  1.2e-14 25.6% 0048865 00488651 1/1   AD(P)-binding domain                    
   3::384  2.7e-14 21.9% 0048494 00484941 1/1   AD(P)-binding domain                    
   1::362  3.3e-14 25.2% 0052032 00520321 1/1   AD(P)-binding domain                    
   1::190  5.6e-14 27.4% 0047068 00470681 1/1   AD(P)-binding domain                    
   2::399  6.8e-14 28.0% 0053321 00533211 1/1   AD(P)-binding domain                    
   1::384    7e-14 27.7% 0044098 00440981 1/1   AD(P)-binding domain                    
   1::421  1.4e-13 25.2% 0047022 00470221 1/1   AD(P)-binding domain                    
   7::390  2.1e-13 23.9% 0045881 00458811 1/1   AD(P)-binding domain                    
   3::177  2.6e-13 24.2% 0047564 00475641 1/1   AD(P)-binding domain                    
   1::384  3.1e-13 25.3% 0035989 00359891 1/1   AD(P)-binding domain                    
   1::363  1.2e-12 30.8% 0040049 00400491 1/1   AD(P)-binding domain                    
   1::386  2.5e-12 24.6% 0036092 00360921 1/1   AD(P)-binding domain                    
 103::317  2.6e-12 28.8% 0038468 00384682 2/2   AD(P)-binding domain                    
   1::392  3.4e-12 27.2% 0049003 00490031 1/1   AD(P)-binding domain                    
   1::383  4.8e-12 29.4% 0040602 00406021 1/1   AD(P)-binding domain                    
   1::390  1.2e-11 27.8% 0046446 00464461 1/1   AD(P)-binding domain                    
   1::390  1.7e-11 23.3% 0046760 00467601 1/1   AD(P)-binding domain                    
   1::387  3.1e-11 24.5% 0046270 00462701 1/1   AD(P)-binding domain                    
   6::103  3.6e-11 32.3% 0042446 00424461 1/2   AD(P)-binding domain                    
   1::384  4.4e-11 23.0% 0046416 00464161 1/1   AD(P)-binding domain                    
   5::115  5.1e-11 29.0% 0050960 00509601 1/2   AD(P)-binding domain                    
   2::391  7.4e-11 24.5% 0047133 00471331 1/1   AD(P)-binding domain                    
   5::126  1.2e-10 28.2% 0048607 00486071 1/1   AD(P)-binding domain                    
   1::384  1.3e-10 24.8% 0048199 00481991 1/1   AD(P)-binding domain                    
   5::386  2.9e-09 21.0% 0045795 00457951 1/1   otide-binding domain                    
   7::165  3.3e-09 25.8% 0052911 00529111 1/1   AD(P)-binding domain                    
   1::383  6.1e-09 24.2% 0040688 00406881 1/1   AD(P)-binding domain                    
   1::178  8.3e-09 24.8% 0047327 00473271 1/1   otide-binding domain                    
   3::116  8.8e-09 22.5% 0047909 00479091 1/2   )-binding Rossmann-fold domains         
   1::196  1.4e-08 21.9% 0052313 00523131 1/1   AD(P)-binding domain                    
   1::416  1.5e-08 24.4% 0041341 00413411 1/1   AD(P)-binding domain                    
   1::129  1.8e-08 26.6% 0050148 00501481 1/2   AD(P)-binding domain                    
   1::163  2.3e-08 23.8% 0046834 00468341 1/1   AD(P)-binding domain                    
   5::103  2.7e-08 26.3% 0048364 00483641 1/2   AD(P)-binding domain                    
   1::103  3.2e-08 27.8% 0045519 00455191 1/2   AD(P)-binding domain                    
   1::102  3.6e-08 28.1% 0046057 00460571 1/2   otide-binding domain                    
   3::49   4.7e-08 40.0% 0047712 00477121 1/2   AD(P)-binding domain                    
   1::101  4.8e-08 24.7% 0048009 00480091 1/2   AD(P)-binding domain                    
 130::355  8.1e-08 21.3% 0047909 00479092 2/2   )-binding Rossmann-fold domains         
   2::391  9.4e-08 24.3% 0046514 00465141 1/1   AD(P)-binding domain                    
   1::101  9.5e-08 24.7% 0053322 00533221 1/2   AD(P)-binding domain                    
 104::318  1.1e-07 23.5% 0042446 00424462 2/2   AD(P)-binding domain                    
   1::128  1.9e-07 27.4% 0047270 00472701 1/2   AD(P)-binding domain                    
   1::353  2.8e-07 23.8% 0047029 00470291 1/1   AD(P)-binding domain                    
   1::100  3.7e-07 26.5% 0044705 00447051 1/2   AD(P)-binding domain                    
   3::101  4.2e-07 31.0% 0038468 00384681 1/2   AD(P)-binding domain                    
   1::391  4.9e-07 21.9% 0045518 00455181 1/1   AD(P)-binding domain                    
 113::317  4.9e-07 23.0% 0047271 00472712 2/2   AD(P)-binding domain                    
   1::368  5.1e-07 23.8% 0048356 00483561 1/1   AD(P)-binding domain                    
 116::316  5.2e-07 24.6% 0049679 00496792 2/2   AD(P)-binding domain                    
   1::101  5.8e-07 25.6% 0048866 00488661 1/2   AD(P)-binding domain                    
   2::103  8.6e-07 24.0% 0036300 00363001 1/2   AD(P)-binding domain                    
   1::101  1.3e-06 23.9% 0038449 00384491 1/2   AD(P)-binding domain                    
   1::102  1.6e-06 27.3% 0050961 00509611 1/2   AD(P)-binding domain                    
   7::207  1.6e-06 21.5% 0047682 00476821 1/1   AD(P)-binding domain                    
   1::100  1.7e-06 23.9% 0036654 00366541 1/2   AD(P)-binding domain                    
   4::100  2.5e-06 24.7% 0048365 00483651 1/2   AD(P)-binding domain                    
   3::101  2.7e-06 28.0% 0047271 00472711 1/2   AD(P)-binding domain                    
   3::101  3.4e-06 26.4% 0048045 00480451 1/2   AD(P)-binding domain                    
   6::108  4.5e-06 30.8% 0046344 00463441 1/2   AD(P)-binding domain                    
   1::99   4.9e-06 27.6% 0036889 00368891 1/2   AD(P)-binding domain                    
   3::101    7e-06 28.2% 0049679 00496791 1/2   AD(P)-binding domain                    
   4::102  7.2e-06 24.1% 0048584 00485841 1/2   AD(P)-binding domain                    
   1::357  8.7e-06 26.7% 0039664 00396641 1/1   AD(P)-binding domain                    
   1::101    1e-05 25.8% 0048200 00482001 1/2   AD(P)-binding domain                    
 123::221  1.1e-05 24.2% 0047276 00472762 2/2   )-binding Rossmann-fold domains         
 142::238  1.1e-05 26.8% 0044559 00445592 2/2   )-binding Rossmann-fold domains         
   4::128  1.2e-05 27.3% 0037643 00376431 1/2   AD(P)-binding domain                    
   1::196  1.4e-05 24.7% 0046128 00461281 1/1   AD(P)-binding domain                    
   3::128  1.5e-05 25.8% 0038074 00380741 1/2   AD(P)-binding domain                    
   1::101  1.7e-05 27.0% 0046972 00469721 1/2   AD(P)-binding domain                    
   3::102  3.6e-05 22.2% 0046761 00467611 1/2   AD(P)-binding domain                    
   6::112  3.7e-05 32.1% 0045481 00454811 1/2    N-terminal domain                      
   1::99   3.8e-05 26.4% 0047565 00475651 1/2   AD(P)-binding domain                    
 113::316  3.8e-05 26.4% 0036301 00363012 2/2   AD(P)-binding domain                    
 136::292  5.9e-05 19.1% 0042534 00425342 2/2   )-binding Rossmann-fold domains         
   6::132  7.5e-05 19.2% 0053383 00533831 1/2   )-binding Rossmann-fold domains         
 123::183  7.5e-05 22.0% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
   1::53   8.1e-05 28.0% 0046579 00465791 1/1   AD(P)-binding domain                    
   3::103  9.6e-05 25.6% 0048108 00481081 1/2   AD(P)-binding domain                    
 112::343  0.00011 20.3% 0037437 00374372 2/2   )-binding Rossmann-fold domains         
 139::292  0.00011 24.2% 0050443 00504432 2/2   )-binding Rossmann-fold domains         
 143::221  0.00011 25.6% 0048102 00481022 2/2   )-binding Rossmann-fold domains         
 138::191  0.00014 29.6% 0045481 00454812 2/2    N-terminal domain                      
 144::182  0.00014 43.6% 0053383 00533832 2/2   )-binding Rossmann-fold domains         
 133::314  0.00026 27.1% 0052964 00529642 2/2   AD(P)-binding domain                    
   6::99    0.0003 19.5% 0041940 00419401 1/2   AD(P)-binding domain                    
 124::182  0.00037 30.5% 0053172 00531722 2/2   )-binding Rossmann-fold domains         
 141::392  0.00039 24.2% 0047270 00472702 2/2   AD(P)-binding domain                    
 107::315  0.00057 28.4% 0036654 00366542 2/2   AD(P)-binding domain                    
 138::315  0.00058 29.7% 0044705 00447052 2/2   AD(P)-binding domain                    
 124::239  0.00072 23.3% 0047278 00472782 2/2   )-binding Rossmann-fold domains         
   3::101  0.00076 22.7% 0036301 00363011 1/2   AD(P)-binding domain                    
 139::232  0.00079 22.3% 0046673 00466732 2/2   )-binding Rossmann-fold domains         
 142::294  0.00099 20.6% 0047992 00479922 2/2   )-binding Rossmann-fold domains         
 143::182    0.001 40.0% 0048585 00485852 2/2   )-binding Rossmann-fold domains         
 143::316   0.0011 33.0% 0038449 00384492 2/2   AD(P)-binding domain                    
 143::233   0.0011 30.1% 0045718 00457182 2/2   )-binding Rossmann-fold domains         
   5::101   0.0013 18.2% 0047276 00472761 1/2   )-binding Rossmann-fold domains         
 131::172   0.0013 33.3% 0042342 00423422 2/2   )-binding Rossmann-fold domains         
 143::316   0.0013 30.4% 0048009 00480092 2/2   AD(P)-binding domain                    
 142::272   0.0015 21.4% 0035535 00355352 2/2   )-binding Rossmann-fold domains         
 109::314   0.0016 28.3% 0047565 00475652 2/2   AD(P)-binding domain                    
 142::193   0.0017 26.9% 0051213 00512132 2/2   )-binding Rossmann-fold domains         
 110::316   0.0018 29.8% 0053322 00533222 2/2   AD(P)-binding domain                    
 112::180   0.0018 26.1% 0035316 00353162 2/2   )-binding Rossmann-fold domains         
   4::101   0.0027 23.1% 0044559 00445591 1/2   )-binding Rossmann-fold domains         
 130::316   0.0028 26.4% 0048866 00488662 2/2   AD(P)-binding domain                    
 144::318   0.0028 32.6% 0050961 00509612 2/2   AD(P)-binding domain                    
 143::316   0.0033 29.3% 0048200 00482002 2/2   AD(P)-binding domain                    
 142::391   0.0034 25.1% 0037643 00376432 2/2   AD(P)-binding domain                    
   1::101   0.0036 18.5% 0047278 00472781 1/2   )-binding Rossmann-fold domains         
 143::190   0.0039 29.2% 0040651 00406512 2/2   )-binding Rossmann-fold domains         
 143::221   0.0043 24.4% 0046357 00463572 2/2   )-binding Rossmann-fold domains         
 140::384   0.0054 26.6% 0036300 00363002 2/2   AD(P)-binding domain                    
 138::191   0.0063 35.2% 0042340 00423402 2/2   )-binding Rossmann-fold domains         
 143::183   0.0076 31.7% 0048027 00480272 2/2   )-binding Rossmann-fold domains         
 143::388    0.008 25.0% 0050960 00509602 2/2   AD(P)-binding domain                    
 144::383    0.013 19.1% 0050148 00501482 2/2   AD(P)-binding domain                    
 140::188    0.014 30.6% 0035405 00354052 2/2   )-binding Rossmann-fold domains         
 143::337    0.014 27.2% 0045519 00455192 2/2   AD(P)-binding domain                    
 143::317    0.015 28.0% 0048584 00485842 2/2   AD(P)-binding domain                    
 143::316    0.016 28.9% 0048045 00480452 2/2   AD(P)-binding domain                    
 143::357    0.017 27.7% 0046344 00463442 2/2   AD(P)-binding domain                    
   1::108    0.018 19.1% 0042534 00425341 1/2   )-binding Rossmann-fold domains         
   4::32     0.023 34.5% 0047992 00479921 1/2   )-binding Rossmann-fold domains         
   6::101    0.023 19.0% 0046973 00469731 1/2   AD(P)-binding domain                    
   6::99     0.025 29.0% 0052964 00529641 1/2   AD(P)-binding domain                    
 141::391    0.034 23.4% 0038074 00380742 2/2   AD(P)-binding domain                    
 143::314    0.046 28.9% 0036889 00368892 2/2   AD(P)-binding domain                    
   1::27     0.047 33.3% 0048454 00484541 1/2   )-binding Rossmann-fold domains         
 143::186    0.048 34.1% 0048227 00482272 2/2   )-binding Rossmann-fold domains         
 110::315    0.053 27.9% 0048365 00483652 2/2   AD(P)-binding domain                    
   3::101    0.057 17.7% 0053172 00531721 1/2   )-binding Rossmann-fold domains         
 143::315     0.06 32.6% 0041940 00419402 2/2   AD(P)-binding domain                    
 130::316    0.064 26.9% 0046973 00469732 2/2   AD(P)-binding domain                    
 143::316    0.067 28.3% 0046972 00469722 2/2   AD(P)-binding domain                    
 140::192     0.09 24.5% 0035477 00354772 2/2   )-binding Rossmann-fold domains         
 144::166      0.1 47.8% 0048454 00484542 2/2   )-binding Rossmann-fold domains         
 143::366     0.11 24.4% 0046057 00460572 2/2   otide-binding domain                    
   3::101     0.21 22.5% 0042342 00423421 1/2   )-binding Rossmann-fold domains         
   1::30      0.25 30.0% 0035477 00354771 1/2   )-binding Rossmann-fold domains         
 143::389     0.41 20.6% 0048364 00483642 2/2   AD(P)-binding domain                    
   1::32      0.45 28.1% 0050443 00504431 1/2   )-binding Rossmann-fold domains         
   5::79      0.63 21.1% 0048227 00482271 1/2   )-binding Rossmann-fold domains         
   2::39      0.79 26.3% 0035405 00354051 1/2   )-binding Rossmann-fold domains         
 144::368     0.87 22.9% 0047712 00477122 2/2   AD(P)-binding domain                    
   6::30       0.9 36.0% 0035535 00355351 1/2   )-binding Rossmann-fold domains         
   1::32       1.2 31.2% 0046673 00466731 1/2   )-binding Rossmann-fold domains         
 143::317      1.2 26.9% 0046761 00467612 2/2   AD(P)-binding domain                    
   5::102      1.3 27.1% 0046357 00463571 1/2   )-binding Rossmann-fold domains         
 141::177      1.3 35.1% 0048108 00481082 2/2   AD(P)-binding domain                    
   1::32       1.4 31.2% 0048102 00481021 1/2   )-binding Rossmann-fold domains         
   5::51       1.7 19.1% 0045718 00457181 1/2   )-binding Rossmann-fold domains         
 357::447      2.1 20.5% 0046156 00461562 2/2   otide-binding domain                    
   5::32       2.9 28.6% 0040651 00406511 1/2   )-binding Rossmann-fold domains         
   4::27       3.7 33.3% 0051213 00512131 1/2   )-binding Rossmann-fold domains         
   3::30       3.8 32.1% 0035316 00353161 1/2   )-binding Rossmann-fold domains         
   4::32       3.8 34.5% 0042340 00423401 1/2   )-binding Rossmann-fold domains         
   4::30       4.5 37.0% 0037437 00374371 1/2   )-binding Rossmann-fold domains         
   5::39       6.2 25.7% 0048585 00485851 1/2   )-binding Rossmann-fold domains         
   5::32       6.6 28.6% 0048027 00480271 1/2   )-binding Rossmann-fold domains         
 350::446       10 21.6% 0048016 00480162 2/2   otide-binding domain                    
   1::455


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRPLRVAVVGAGPAGIYASDLLMKSDTDVQIDLFERMPAPFGLIRYGVAPDHPRIKGIVKSLHNVMDKE
00480161   1/2  --tgkkVavvGaGpAGlaaAaqLaraldlseelghdvtvferlprpggllrygiapdfrlpkevvdrlvd
00461561   1/2  ---gkkvaviGaGpaGlaaAllLakalpghdvtvfEkgpvpggllrygiapdfrlpkelldrlielleel
00360162   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00529631   1/1  mptkkdVaiIGAGpaGLaaAllLaraGhdldVtvfErrdrpGGlwrttgrigsgldlgpsllrlleelgl
00471411   1/1  mstkkdvaiiGaGpaGlsaAiyLaraGld.dvtvlEkndrlgGrll.ggipgfalpaelldalaelaekl
00503641   1/1  --epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaaelaka..glevtvfertpr
00364591   1/1  mgrvcppcegaclllllagpvailllepaladelllgllplllpamskkkdvvvvGaGpaGlaaAlalar
00503631   1/1  masmsmkydvvIiGaGpaGlaaAlrLar..aGlkvtvlEkgprlGgtwrtgrypglllllpallyllldl
00374411   1/1  MpvligllesliidtalllgllpplsaskkydvvviGaGpaGlaaAleLara..GlkVtvlEardrlGGr
00488071   1/1  irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaAlalara..Glk
00435771   1/1  M...kdVaviGAGiaGlaaAyeLara..GlkVtvlEardrlGGrsrtvgypgfrldlgaglipgsypyll
00526001   1/1  MseeyDvvvvGaGpaGltaAleLaraG..lkVlllEagdrvgGtslrngglphkglreladrlielleel
00492221   1/1  MmktpvliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeLara.pGlkVlvlEkgdrl
00509271   1/1  ----vydvviiGaGpaGlaaAlrlaraglklsevlllek.drlggtilllggvpsglllgaalllallel
00467501   1/1  --kkkdvvvvGgGpaGltaAlrlarlgpdlevtliekgdrlggtpllpgvlggkllaelllrllelllkl
00360161   1/2  -----prklgiPGedlpgvfsardfvawynglpdaallepdltgkrVvviGgGpaGldaArlllksldel
00457971   1/1  -sekydvviiGaGpaGlaaAlrlarl.aglkvlliekgrlgglllllayggillrvgfiplkrl.aelle
00499901   1/1  ---kkdvvviGAGiaGlaaAlrLaea..GhkVtvlEardriGGrsrtnggllipglrldlgahlfpgsye
00491501   1/1  MirvcpalceslvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLara..GlkVtvlEardrlGG
00406191   1/2  -----prvlpipGedlcgvlslrdfvgdynlhpaawllppdltgkrVvviGaGpaGldaArellkdldll
00462741   1/1  mlMkkkyDviiiGaGpaGlaaAleLara..GlkVlvlEkgdrlGGtwasngipgipsdggaavilgpell
00529261   1/1  lniksielflsiieraldeglvppsmemmmekydvvIiGaGpaGlaaAlrLlqlAaraGpdlkVtvlEkg
00485831   1/1  --lsedkeyDVvviGgGpaGlaaAlalara..GlkVlllEkgpelggtclaaggipskallllalgllll
00400351   1/1  M..eyDvvvvGaGpaGlaaAlrLara..GlkVlvlErgdrpGGtsltnggpgfkldlgaalllgpellee
00458701   1/1  ----ydVvvvGAGiaGlaaAlrLaea..GltdvlvlEagdrvGGrartvrypgfrfdlgahvflgpggel
00488651   1/1  m.lpkdvviiGgGpaGleaalalarlglklevtliergdrlggtllplgpgpllglldaeelaeylrell
00484941   1/1  --aakkydvvIiGaGpaGlaaAlrLara..GlkVtvlEkgdrlGGrsrtggypgfpiidsgallfpellp
00520321   1/1  MmdeeyDvviiGaGpaGlsaAlrLara..GlkVlvlEkgpllggtsglngggihag..lskllldlrdll
00470681   1/1  lllllmmmlhydvvviGgGpAGlaaAlrlarldpgarvlliekepglgynrgclpkklllaaaelldlll
00533211   1/1  -mekydvviiGaGpaGlaaAlrlara..GlkvlvlEkgprpgglsrlnggggaaldlpsklllrlldll.
00440981   1/1  MeskkydvvviGaGpaGlaaAlylara..glkvtllekgprlggllntgcgpsklllpgallgaelveal
00470221   1/1  m...yDVvviGgGiaGlaaAlrLara..GlkVlvlEagdrlGGrlrtvrlgggtsldlggivfpglypal
00458811   1/1  ------llydvvIiGaGpaGlsaAlrLara..GlkVlvlEkGplvnrdrlGGtsnggdgrldlgahvffl
00475641   1/1  --lldkeyDVvviGgGpaGlaaAlrlara..GlkvlllEkgdrlgGtclnsgcipskalllaalglllll
00359891   1/1  MkeldeeyDvviiGaGpaGlsaAlrLaraG...kVlvlEkgpvlggtsglngggipggllld........
00400491   1/1  MkdleyDvvvvGaGpaGlaaAlalaragpdlkvaliekgplggga........sclngggipakllledl
00360921   1/1  pplmmdeeydvvViGaGpaGlaaAlrLara..GlkVlvlErgGrlasgripgklldggahllpglleell
00384682   2/2  ----------------------------------------------------------------------
00490031   1/1  lMlpeslleplpalsaseeydVvViGaGpaGlaaAlalara..GlkVlllEkgprlggtsclnggglppg
00406021   1/1  Ms.eyDvvvvGaGpaGlaaAlrlara..GlkvlllEkgdrlggtsllgggllnag...............
00464461   1/1  MmplslllatalelplpalaldkkyDvvViGaGpaGlaaAlalara..GlkVlllEkgdrlGGtsltagg
00467601   1/1  M.keyDvvviGaGpaGlaaAlrlarlgld.kvlviekgpllggqtllllggtclnvgcipskllllaall
00462701   1/1  MMsplllalllllpllllaldeeydvvviGaGpaGlaaAlalara..GlkVlllEkgdrlGGtslrsggi
00424461   1/2  -----vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpaGlaaAlyLarlGa..evtvierrpr
00464161   1/1  M.leydvvviGgGpaGlaaAlrlara..GlkvlliekgdrlGGtllntgcipgkalllgalllellrell
00509601   1/2  ----kdvvviGgGpaGleaAlalar...glkvtliergdrlggtrpllsgvipgklldeelaeylrelle
00471331   1/1  -tmkydvviiGaGpaGlaaAlrlara..GlkvlllEkgprlgyktllalGgllltvglipgkallgaall
00486071   1/1  ----myDvviiGaGpaGlaaAlrLara..GlkVlvlEk.drlGGtclnvgcipskallyagllpdelell
00481991   1/1  klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgGpaGlaaAaylarl..Glkv
00457951   1/1  ----yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEkgdrlGGtsglnaglippglggplddrgla
00529111   1/1  ------llsnlplgrllpfllptslwldtlplpllellisraileralpdldmdkeyDVvIvGAGpaGLs
00406881   1/1  MsskeydvvviGgGpaGlaaAlrlara..Glkvlllekgdrlgglllagcipgkallaaalllrllella
00473271   1/1  M...yDviviGaGiaGlaaAyrLaka..GlkVlvlEkgdrlGGraatfrldgfrvdnvgahpfkglnpel
00479091   1/2  --mmsylplfldlkgkrVliiGgGpaGltaAlelakaGa..kvtlverdprpelallllelleklgvevl
00523131   1/1  ms..ydVvvvGAGiaGlsaAlaLarr..Glrvlllergdvlggascrnsggglakgllleelpalggvdr
00413411   1/1  MpmsseeyDvvViGaGpaGlaaAlrlara..GlkVlllEkgpvlgGtssrn....qggirldlgaipl..
00501481   1/2  lmeleydvvviGgGpaGlaaAlylara..glkvtliekgplllyalgglllyvgcilskallllgilgee
00468341   1/1  smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvlEkgprpggrsr.ggglypgglellrelgl
00483641   1/2  ----ydvviiGgGpaGltaaiylarlgpdlkvtliekggtclyvgcllskalgllglldeelalrllell
00455191   1/2  ppipgvellltsddalalkelpkdvvviGgGpaGleaAlalarl..gakvtlierrdrllgtl.......
00460571   1/2  pmmskkkdvvViGaGiaGlsaAlaLara..GysVtvlErgdrpggtsgtnggllaaglvapllllpggip
00477121   1/2  --ektdVaIvGAGpaGlaaAlaLara..GldvtvlErrdrpggtalgrg---------------------
00480091   1/2  ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarl..gaevtvvergdrlgglld......
00479092   2/2  ----------------------------------------------------------------------
00465141   1/1  -eieydvvViGaGpaGlaaAlrlara..GlkVtviEkgprlggclnvgcipgkaldaaall....lrlle
00533221   1/2  ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarl..gaevtvvergdrlgglld......
00424462   2/2  ----------------------------------------------------------------------
00472701   1/2  ledllldllsmstkkdvvviGaGpaGleaAlalarl..glkvtlierg..lGgtllnggpglskplllrv
00470291   1/1  lllllslsllllllsslllmmskeyDvviiGaGpaGlvaAlrLae.laGlkVlvlEaGGtarnggyigsk
00447051   1/2  arprllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlylarlga..kvtlierrdr
00384681   1/2  --tgkdVaViGaGpaGldaAlylarlgak.kvtlverrdrlg.......fpafp.......elvellkee
00455181   1/1  Ms.eydvvviGgGpaGlaaAlrlaea..GlkvlvlEkgdrlgglsnrngipglrlllgalllrllellee
00472712   2/2  ----------------------------------------------------------------------
00483561   1/1  MskkydvviiGaGiaGlsaAlrLara..GlkVlllEkgdrlGGtsgrnaglipgglrldaall.......
00496792   2/2  ----------------------------------------------------------------------
00488661   1/2  srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlga..kvtlvergd
00363001   1/2  -mekydvvviGaGlaGlsaAlelaragl..dvtvlergprlggcllllsvpggrldpeelvlalaellee
00384491   1/2  lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlgl..kvtvver.drlggtl.........
00509611   1/2  lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarl..glkVtliergdrlg
00476821   1/1  ------lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlrLae...GlkVlvlEaggrlg
00366541   1/2  vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarl..gakvtvvergdrlggtld...
00483651   1/2  ---ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGleaAlalarlGa..kVtviergdrl
00472711   1/2  --PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarlgl..kvtllerrprlg
00480451   1/2  --pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarl..gakvtlverrdrlgglld.....
00463441   1/2  -----rVlVvdgGgGpaGleaAealarrGhe..Vtlvealdrlggllrlgipdpller..........le
00368891   1/2  ppipglellltsddalellelpkdvvviGgGpaGleaAlalarl..glkvtliergdrlgglld......
00496791   1/2  --PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAlylarlgl..kvtlierrdrlggd.
00485841   1/2  ---rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAlalarlg..akvtvvergdrllgtl
00396641   1/1  MsylasaallaalpslletieyDVlviGgGpaGlsaAlelarlapdaGlkValvEkgdlgggasgrsggg
00482001   1/2  llpipglevltsdgaldllelpkdvvviGgGpaGleaAlalarl..glkvtlvergdrlggtl.......
00472762   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00376431   1/2  ---eydvvvvGaGpaGlaaAlalara..glkvlllekgprlg.gllvglipskllllrvlgaelaaalae
00461281   1/1  glellllslltemmskeyDvvvvGaGpaGlvaAlrLae.daGlkVlvlEagdrlgGascipsgaglgadl
00380741   1/2  --keydvvviGgGpaGlaaAlrlara..Glkvlllekgdlgggclnvgcipgkrllaaaelydelrelle
00469721   1/2  dlpgvellltsddalalkelpkdvvviGgGpaGleaAlalarl..gakvtliergdrllglld.......
00467611   1/2  --gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpegakvtlvergdrllpcld.......
00454811   1/2  -----rVvViGaGlsGlaaarlllrlGaevtv..ldrrdrpggl..........................
00475651   1/2  pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarl..gakvtvvereprlggtld.....
00363012   2/2  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00533831   1/2  -----lellgvallevlgkrilkgkkvaviGaGgvGlalAllllelgvaa.eVtlvDiddelleglalel
00484141   1/1  ----------------------------------------------------------------------
00465791   1/1  m.keyDvvIiGaGiaGlsaAlrLaka..GlkVlvlEkgdrpGgrgasgrnagg-----------------
00481081   1/2  --aalliliaslglellpadylvlaigssdgaldlpklpkrvvvvGgGyiGlelAaalarllpelgaeVt
00374372   2/2  ----------------------------------------------------------------------
00504432   2/2  ----------------------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00419401   1/2  -----lPdipglelvltsddalelkepkkvvviGgGyiGleaAsalrrl..gaevtliergdrllpll..
00531722   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00363011   1/2  --ppipgldlegvftlrtlddalalreallagkrvvvvGgGlaGleaAaalrrl..glevtlvergdrll
00466732   2/2  ----------------------------------------------------------------------
00479922   2/2  ----------------------------------------------------------------------
00485852   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00457182   2/2  ----------------------------------------------------------------------
00472761   1/2  ----ysrplllgligllgakvlpgkkvaviGaGgvGlalAlalaaagaagevtlvDideekleglardll
00423422   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00512132   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00353162   2/2  ----------------------------------------------------------------------
00445591   1/2  ---pkkvaviGaGgvGlalAllla.aagggdVtlvDidp..............ekleglaadlldilell
00488662   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00472781   1/2  ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvlvdideekleglalel......
00406512   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00354052   2/2  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00425341   1/2  lsmvlkgkkvaviGaGliGlalalllallgl.geVvlyDinp..............ekleglaadladil
00479921   1/2  ---pkkvaviGaGavGlalAlalaraGaageV--------------------------------------
00469731   1/2  -----dipglellltsddalalkelpkdvvviGgGyiGleaAaalarl..gaevtlvergdrllpyldce
00529641   1/2  -----rVvViGaGaSgldialelakv..aksvtllersdelggpw.........................
00380742   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00484541   1/2  mmkklkvaiiGaGniGlalarallala-------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00531721   1/2  --rrsrlllliglegqeklkgakVaviGaGgvGlalAllLalagvagevvlvDidevklsnlardllh..
00419402   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00354772   2/2  ----------------------------------------------------------------------
00484542   2/2  ----------------------------------------------------------------------
00460572   2/2  ----------------------------------------------------------------------
00423421   1/2  --ldllplfldlrgkdvlviGgGdvGlaaarllleagakvtvve......................rrll
00354771   1/2  MlkgmkvlVtGAaGgiGsalalrlaargla----------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00504431   1/2  lmeikkvaviGaGlmGlgiAavlaraGleVvl--------------------------------------
00482271   1/2  ----mkiaviGaGyvGlplAallaeaGheV..vgvDideekvealndgilpile..pgleellrdlldag
00354051   1/2  -lkpmkvlvtGAaGfiGyalalllaaggladldllvelv-------------------------------
00477122   2/2  ----------------------------------------------------------------------
00355351   1/2  -----GkkvaviGlGsmGlalAallaaaGh----------------------------------------
00466731   1/2  mlkikkvaViGaGlmGsgiAavlaaaGikVvl--------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00463571   1/2  ----mKiaviGaGyvGlelAavla.lgh..eVtlvdinp.........................ekleal
00481082   2/2  ----------------------------------------------------------------------
00481021   1/2  lllmlkmmkiaviGaGavGtalAallaenghe--------------------------------------
00457181   1/2  ----mKiaviGaGyvGlslalllalkgladevvlvDideekleglaldlsd-------------------
00461562   2/2  ----------------------------------------------------------------------
00406511   1/2  ----mhviiiGlGrvGlalarlLlelgidvvv--------------------------------------
00512131   1/2  ---mkkvaiiGaGyiGlslalllaekg-------------------------------------------
00353161   1/2  --GgshdrseaTaygvvagleealkllgld----------------------------------------
00423401   1/2  ---aGylavllaalllcrflgglgllltlagg--------------------------------------
00374371   1/2  ---agrlavleaalllervltglgalagll----------------------------------------
00485851   1/2  ----mKiaviGaGnvgsalalllalagladelvlvDide-------------------------------
00480271   1/2  ----mhviiiGlGrvGrlvarlLlelgidvvv--------------------------------------
00480162   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QLRFLGNIEVGKDITVEELREFYDAIVFSTGATGDQDLRVPGSDLEGSWGAGEFVGFYDGNPNFERNWDL
00480161   1/2  lledlgvefvlnvevgvdvtldellleydavvlAtGatkprllgipgldldgvysaldflfgynllldgl
00461561   1/2  gveirlntevgkdvtledllleydavvlAtGalsprllgipgedlpgvvlaldflllgnllpg.......
00360162   2/2  ----------------------------------prklgiPGedlpgvfsardfvawynglpdaallepd
00406192   2/2  ----------------------------------prvlpipGedlcgvlslrdfvgdynlhpaawllppd
00529631   1/1  ldelleeglsplypglrldvpkelygfpdfplpgwfpvfpgrkelldyladlaeklgveirlnteVtsve
00471411   1/1  gveirlgtevdgvtvttedgetieadavvlAtGalrprllpipgldlpgvlgvhsll......savllgl
00503641   1/1  igglw..rgipypplgkelldyleeyarklglrirfgtevtsvdrdgwtvtgeeltleadavvlatGasv
00364591   1/1  a..Glkvtllekgdrlggrlllvggipggvlpeelvealaelleklgveirlgtrvtdgvgvttedgeti
00503631   1/1  pllfglpppggggvdraelldylleaaerlgvedvirlgtev.tsidfdedgvvvgvttedGetieadav
00374411   1/1  lrtaripglgasldlggilfpglsprllellaelgleaelarllglrvlilldgtvvsldgdldfevlla
00488071   1/1  VtllEardrlggrlllsggipgkvdpaellealaelaeelgveirlgtrv..D...dgetiradavvlAt
00435771   1/1  elleelglelairlntevggavllpdgglltvprdladllaellaladgllleadavilAtGa.rprlpp
00526001   1/1  gvelllntvvgalltlaellaeydavvlalglglatglagrglavprgrvlggssvingavylradaidf
00492221   1/1  GGtsrnggvipdgglldpelldlleelGlpfdlllpgggvvdpaellralaealaeelgveirlgtevtd
00509271   1/1  leklgveillgtevtsidldggtvvgvttgdgetltad..vlAtG.arprllllllvpgipgfdgkgvht
00467501   1/1  gvevllg.evtsidpdgktvtledgetleydllvlAtGar.prllpipgldl...egvltlrtlldalal
00360161   1/2  lktdindlalealkrlggkeVtvveRrgple---------------------------------------
00457971   1/1  allelaeklgveillgtevtdidldddvvvvltdgetitltadavvlAtG.srprllpipgldlegvlts
00499901   1/1  llldlleelgvelrlntrvvvdrdgklvtvpldldgleleadavvlatGalsllprlpdipgldlf...s
00491501   1/1  rsrtaglippgflldlgahvfpg.laplllelleelglelelltlagaavlalldgklidlpadvarlla
00406191   1/2  lktdisdnaleallarlgaevtvvgRrgplia--------------------------------------
00462741   1/1  ellrelgielgpkvpeildyllklldkfdllklleflskvngveyiegrasfldagkwevltedgwgife
00529261   1/1  drlGGtsrtnggliprgl.............................................eelldel
00485831   1/1  elaallgillllllldlllllrrllllllllaagvegllillgvevvvgvadgggvtvvtgdgetirada
00400351   1/1  lgteaaellaergvrvlrgkglgggstin.....adavvlatg.adprllgipgldydfllpgvhsaeda
00458701   1/1  leylldlleelgleddlrlntevggarlllpdgkllvltsdlnalllelradalilatgal.prlppipg
00488651   1/1  eklgvevllgtevtsidgdgkgvtledgetleadlvvlatGa.rpntppipgldllgvldvrgai.vvde
00484941   1/1  yllellkelglelrlpdlggrvvvlpdgkvlgyd............................lglgalpd
00520321   1/1  eelgvelllggaglvdprgvellgelgleadalllatG..rpfdlpipglelfgvrglltlldalklepl
00470681   1/1  elaglgllllvaagdldaeelvlalaelleelgvevllgtrvtgidpdgvtvtladgetitadklvlAtG
00533211   1/1  ......................................................................
00440981   1/1  lelleelgveillgtevtsidldgggvvltdgetieadavvlAtGar.prllglpgldlpggl.......
00470221   1/1  lelleelglelallaldgellayldglvlelgidlntlvvaldpdalevlledleelradavvlAtG.sr
00458811   1/1  llppgllellaelglplglelldlleelleelgidfllgkgvgglsaingvvlergsaedydalipatga
00475641   1/1  gaalfglllllllllldlvllgaakralgaellrllaelaeklgveillgtavtellkddggvvvtgdge
00359891   1/1  dllerlgedlliglallvdgdlvvvltgegleadalllatGa.pprlldipgldelggllsldal.....
00400491   1/1  lerlvvdllkggailvdedlvelldgealeadalllatGarpr..lgipgsdlpgvlla...........
00360921   1/1  aglgdlaellalkpelvalledgaailllprgvrllaglglggssainagvylrvspadfdelgawgvtl
00384682   2/2  --------------------------------ftprvlpipgeeacglltadepvailflerlihsyavk
00490031   1/1  glrylag..lglldlleelaeelgidldflrdgllvlaldgegleadalllatGa.pprlldipgldllg
00406021   1/1  ......dildklgllaallvrladalvlatga.rprrlgipglelp........................
00464461   1/1  illdlgarllegl..glldlleelleelgielrllrdgklvvaltgegleadavllatGa.rprllpipg
00467601   1/1  pellelleglgvefdle...ekgvdldglrlaydklv.................................
00462701   1/1  lldgglrllegl..glldrleelleelgieldllvdgrlvvaladealeadalllatGa.rprllpipgl
00424461   1/2  lggtllalgripakllglealllrllllllglg-------------------------------------
00464161   1/1  elgglflllpdldlelllelldalv.............................................
00509601   1/2  klgvevllgtevtsidgdgkgvtlddgeleadavvlatGsr.pnt-------------------------
00471331   1/1  ......................................................................
00486071   1/1  eelglpllpgldipvlpgrkgggreellrylaealeklgveirlgtalfvdpnrVt--------------
00481991   1/1  lliekgprlggtclnvgcipskallkaaelaeliellpglgvelllg...glgldlaellerkdavv...
00457951   1/1  laeetlellrelgaelgl.ldglvrpngalvl.............................aigledade
00529111   1/1  aAyyLakarPglkVlvlEkgdrpGGasgrnggilpsglltdellelleelgipfdpegpgggtvdgaalv
00406881   1/1  elgiellllpypgvdlslv...................................................
00473271   1/1  ldllkelgledkldlrrlvllrgkvlggpsdlngllavrgdedlleakalllatg...pylpllpglsle
00479091   1/2  lgtrvteiakeylpelllgveveagdgvvtvvlgdgetieadlvil------------------------
00523131   1/1  arlaaalaeaaealgveirlgtevtdllleggrvtgVrtadGetlradavvlAtGafsr.lllllglelp
00413411   1/1  ..dlleelgldl...vkggdgltleagalvlatg.arpripplpglgvpgvltsdgalalrep.......
00501481   1/2  llarlreqleklgveillgtrvtsidldggtvvltdgetieadavilAtGvlvaigrrp-----------
00468341   1/1  edeleelgvdflkalvvlldldlvlalrllgpdvtggerrpragvvdraellralleaaeelGngrveir
00483641   1/2  eklgvelllgtevtsidlegktvtllllvlgdg-------------------------------------
00455191   1/2  ...dpelskallelleklgvevllgtevteidg-------------------------------------
00460571   1/2  llalalealdllrelglelgidf....rvgal--------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00480091   1/2  ....eelsllllelleklgvelllgtrvtai---------------------------------------
00479092   2/2  -----------------------------------------------------------mmsylplfldl
00465141   1/1  lleelgvelrlppldglllpgvgdvl............................................
00533221   1/2  ....eelslallelleklgvelllgtrvtai---------------------------------------
00424462   2/2  ---------------------------------vPrvlpipgidlggvlhaldfldp..........kal
00472701   1/2  lgpelaeylrelleklgveillgtrvtsidrdgdtgrvtgvtledgetleadavvlAt------------
00470291   1/1  pdlgaalfgelldelyelgle.ldgrrllfprgkvlGGsssinggvylrgskndfdlwaglaglegwsyd
00447051   1/2  lggtl...............dlllellekl----------------------------------------
00384681   1/2  gveillgtavleilgddgkvtgvrvvrveld---------------------------------------
00455181   1/1  lgipfdlpglgglflprggrvdgaelaaalaeaaeel.gveillgtrvt.idggvvgvttdgetiradav
00472712   2/2  ------------------------------------------Prlpdipglelflgkgvhtsatldgllf
00483561   1/1  ................lvrlalesldalreliatgar.plglpipgrdlgglllardaldldalpkrlav
00496792   2/2  ---------------------------------------------Pgipgleeflgkgvhtsatldglef
00488661   1/2  rlggtlld..........eelaaallellek---------------------------------------
00363001   1/2  lgvevrlgtevtsidrdgdgvtledgetleada-------------------------------------
00384491   1/2  .dcilskallelleelgvevllgtevtevel---------------------------------------
00509611   1/2  g.ld..........pelskallelleklgvel--------------------------------------
00476821   1/1  grgatpsgggflvdtgadwlfgtepelglegrgillprgkvlGGsslinggvlvrglpedfdal......
00366541   1/2  .......pelskallelleklgvevllgte----------------------------------------
00483651   1/2  ggrlld..........eelalallellekl----------------------------------------
00472711   1/2  gtl...............dlllelleklgve---------------------------------------
00480451   1/2  .....pelaaallelleklgvelllgtrvta---------------------------------------
00463441   1/2  elgveillgvavteilgdgvelgeeleleaDlvvlatg--------------------------------
00368891   1/2  ....pelaaallelleklgvevllgtevt-----------------------------------------
00496791   1/2  ...........pelleyllelleklgveill---------------------------------------
00485841   1/2  d..........pelsklllelleklgvdlllg--------------------------------------
00396641   1/1  iaaglrllienylgl...........................dlaellvedlvkggaglvdedlve....
00482001   1/2  ...dpelsklllelleklgvevllgtevtai---------------------------------------
00472762   2/2  ----------------------------------------------------ysrplllgligllgakvl
00445592   2/2  ----------------------------------------------------------------------
00376431   1/2  aleelgvevllgtevtsidrdgggvtgvllvttgdgetiradavvlAtGarpntp.ll------------
00461281   1/1  gltllpglfdtll......agldgrdllarrgkvlggsslingmvylrglpedldelakllgve......
00380741   1/2  elgipfdevllglllllgrggadgaelaaalaelleelgvevllgtavtiddgr.Vtl------------
00469721   1/2  ...pelskallelleklgvelllgtevtaid---------------------------------------
00467611   1/2  ...pelsklllelleklgvdvllgtevtaidv--------------------------------------
00454811   1/2  .lllelgvefvlgslllellleadlvvlspgvpldhpllela----------------------------
00475651   1/2  .....pelskallelleklgvelllgtev-----------------------------------------
00363012   2/2  ------------------------------------------ppipgldlegvftlrtlddalalreall
00425342   2/2  -----------------------------------------------------------------lsmvl
00533831   1/2  gdiisllgk....................alkvdtddeealldaDlvilatgaplkpgqevl--------
00484141   1/1  ----------------------------------------------------dyiglvnllkkl..gldl
00465791   1/1  ----------------------------------------------------------------------
00481081   1/2  lvergdrl........lpglld..eelaellle-------------------------------------
00374372   2/2  -----------------------------------------agrlavleaalllervltglgal..agll
00504432   2/2  --------------------------------------------------------------------lm
00481022   2/2  ----------------------------------------------------------------------
00454812   2/2  -------------------------------------------------------------------tdl
00533832   2/2  ----------------------------------------------------------------------
00529642   2/2  --------------------------------------------------------------ayrdpedf
00419401   1/2  ........deelsllleelleelgidvll-----------------------------------------
00531722   2/2  -----------------------------------------------------rrsrlllliglegqekl
00472702   2/2  ----------------------------------------------------------------------
00366542   2/2  ------------------------------------vlpipgldgegvltsrdlldllel..........
00447052   2/2  -------------------------------------------------------------------arp
00472782   2/2  -----------------------------------------------------ldifvkrlikelivvkl
00363011   1/2  lpyl.........rpelskallelleelgve---------------------------------------
00466732   2/2  --------------------------------------------------------------------ml
00479922   2/2  ----------------------------------------------------------------------
00485852   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00457182   2/2  ----------------------------------------------------------------------
00472761   1/2  dilellgv....................glv---------------------------------------
00423422   2/2  ------------------------------------------------------------ldllplfldl
00480092   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00475652   2/2  --------------------------------------pipgldlegvltsrdlldllel..........
00512132   2/2  ----------------------------------------------------------------------
00533222   2/2  ---------------------------------------ipgldlegvltsrdlldllel..........
00353162   2/2  -----------------------------------------GgshdrseaTaygvvagleealkllgldl
00445591   1/2  lve.....rlitttdleealadaDvviiavg---------------------------------------
00488662   2/2  -----------------------------------------------------------srprvlpipgl
00509612   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00472781   1/2  .....idillpklvdvvvttelkevlkg...---------------------------------------
00406512   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00363002   2/2  ---------------------------------------------------------------------m
00423402   2/2  -------------------------------------------------------------------aGy
00480272   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00354052   2/2  ---------------------------------------------------------------------l
00455192   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00425341   1/2  elllvk....grirattdlyealkgaDvviiavgvprk--------------------------------
00479921   1/2  ----------------------------------------------------------------------
00469731   1/2  lskall..........elleklgvdlllgtk---------------------------------------
00529641   1/2  .....lgvvillnteveevtgdgvvledg-----------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00484541   1/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00483652   2/2  ---------------------------------------ipgldlpgvlllltsd...dalallelllla
00531721   1/2  ..................iladlgvpkvvva---------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00469732   2/2  -----------------------------------------------------------dipglelllts
00469722   2/2  ----------------------------------------------------------------------
00354772   2/2  ---------------------------------------------------------------------M
00484542   2/2  ----------------------------------------------------------------------
00460572   2/2  ----------------------------------------------------------------------
00423421   1/2  prlaalaeelgvevvlgd......fleedlg---------------------------------------
00354771   1/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00504431   1/2  ----------------------------------------------------------------------
00482271   1/2  rltattdla-------------------------------------------------------------
00354051   1/2  ----------------------------------------------------------------------
00477122   2/2  ----------------------------------------------------------------------
00355351   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00463571   1/2  negllpilelgldelveellgnltattdleea--------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00457181   1/2  ----------------------------------------------------------------------
00461562   2/2  ----------------------------------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00512131   1/2  ----------------------------------------------------------------------
00353161   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00485851   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00480162   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SAEKVAVVGVGNVALDVARILAKTGDELLVTEIPDNVYESLAKNQAKEVHVFGRRGPAQAKFTPLELKEL
00480161   1/2  yllgllargkrvvviGggntaldvartllrlg....................a.svtlverrgrllapas
00461561   1/2  ..krvvviGgalrlldgvigntaldvartlarlg.....................akvtlverrgl.llp
00360162   2/2  ltgkrVvviGgGpaGldaArlllksldellktdindlalealkrlggkeVtvveRrgpleapftlkelre
00406192   2/2  ltgkrVvviGaGpaGldaArellkdldlllktdisdnaleallarlgaevtvvgRrgpliaaftlkeler
00529631   1/1  rdgdgvtvttedgepdgeeetleadaVvlAtGal.srprllgllpdipgldlfggrvlhsalyldnldll
00471411   1/1  lllgkrvvvigggdigllaelalalarlgal....................kvtlverrdrllpradpel
00503641   1/1  prlpdipgldlfggllahsflrrkirelvkdpelaelltplllflgkrvvvigggysgv...........
00364591   1/1  eadavilAtGar.pntllllrggivvdeylrtsvpgifaagdv---------------------------
00503631   1/1  vlAtGalsrprlppsipgldltfkggvtlsavw......sdgalallgllvdllp---------------
00374411   1/1  dgeeleadalilatGa.rprllpipgfdgkgvltardlldll...........flgkrvvviGggvsgle
00488071   1/1  Gar.prllplpgld...................-------------------------------------
00435771   1/1  ipgldlkg......vltsrdll.......dllgkrvvviGgGasgldiaealarlgaevtvverrprlla
00526001   1/1  atgargipgwdldgvlpyfdrledslgv....lglpflgkrvvviGggpigvefaealarlgakvtl...
00492221   1/1  ilrdggrvtgvttedllvdkngvevtdgdggtirada---------------------------------
00509271   1/1  artlldld...........llgkrvvviGggaiglelal...............................
00467501   1/1  realldlllllkgkrvvvvGgGliGlelaaalaelglevtlve---------------------------
00360161   1/2  ----------------------------------------------------------------------
00457971   1/1  ptsildalall......lellpgklvviggGai.....................................
00499901   1/1  leellsalgll.......dllgkrvvvigggasgvdlaellarlgarvtllerldglllpg.........
00491501   1/1  arlvrlldgleleadalilatGarprlllpipgldlfgvlgrvllssdlllgll......llgkrvvviG
00406191   1/2  ----------------------------------------------------------------------
00462741   1/1  eeltadaviiatGa.rpripdlipgl.gggvltsddyldled..........lpgklvdfvllalalaia
00529261   1/1  gipgalldagfpydgllfvfgg................................................
00485831   1/1  vilAtGar.srvppipgldlpgvltsrtaldllfl..---------------------------------
00400351   1/1  lg.......ldllgkrvvviGggysgvelaealarlgap..vtlldrsplarlpp........glls...
00458701   1/1  ldlgevlhsagyeellr.....rlgldllgkrvvvigggasavela.alaragasvtlllrsp.......
00488651   1/1  ll.......qtgkpvvvaggdvagleglllgll-------------------------------------
00484941   1/1  spealgleefpgrvvvigggyiglelagkrvrvgg....................akvtllqrrppfvlp
00520321   1/1  llssdlaggllypgkrvvvigggaille..........................................
00470681   1/1  a.rprllpipgldl...pgvlvlrtlddalalrellaallpkrvvvvGgG--------------------
00533211   1/1  .................lelaellarlgaevlrlllglltllergdrllp....................
00440981   1/1  ......................................................................
00470221   1/1  prlppipgedlggvlhsallldll.............gkrvvvigggasgldlaellarlgaevtvvler
00458811   1/1  edflgglflpaegilgatgsepfllpgvsllrvldsagalslafrgkrvvvrltyddnyfndeyqglper
00475641   1/1  tiradavilAtGar.srvppipgldgpgvltsdtale---------------------------------
00359891   1/1  ...........ggrvvvigggviglelaralle.....................................
00400491   1/1  ........lgkrvvvvgggviglelaaal.........................................
00360921   1/1  ddlepyfelaadalvlatG.srprlpplpglelggvlltaaealgl..........dflgkrvvviggga
00384682   2/2  dgppftgkdVaViGaGpaGldaAlylarlgakkvtlverrdrlg..........................
00490031   1/1  .........................grvvvigggvdglelaralae........................
00406021   1/1  .ggrvvvigggviale......................................................
00464461   1/1  ld.........................llggrvvvigggviglelaralae...................
00467601   1/1  ......................................................................
00462701   1/1  d.........................llgglvvvigggviglelaralae....................
00424461   1/2  ----------------------------------------------------------------------
00464161   1/1  ......................................................................
00509601   1/2  ----------------------------------------------------------------------
00471331   1/1  .......................lelaelleelgvevtllellggdrvlprldldg..............
00486071   1/1  ----------------------------------------------------------------------
00481991   1/1  ......................................................................
00457951   1/1  larl.gkrvavlgggel.....................................................
00529111   1/1  ralaeaaleelgveirlgteVtdil---------------------------------------------
00406881   1/1  ......................................................................
00473271   1/1  evl............dsl.lgldllpklvlvigggvig--------------------------------
00479091   1/2  ----------------------------------------------------------------------
00523131   1/1  vgptlgyalvtdllell........gkrvvvvgggktgtelaldlrsigasvtlfq--------------
00413411   1/1  ....gkrvvviggglsglel..................................................
00501481   1/2  ----------------------------------------------------------------------
00468341   1/1  lgtrvtsierdgelledleeypv-----------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00479092   2/2  kgkrVliiGgGpaGltaAlelakaGakvtlverdpr..................................
00465141   1/1  ......................................................................
00533221   1/2  ----------------------------------------------------------------------
00424462   2/2  kgkkVaviGaGpaGlaaAlyLarlG.....................aevtvierrprlggtllalgripa
00472701   1/2  ----------------------------------------------------------------------
00470291   1/1  ellpyfkkaekliiatg.srpllpdlpgglllggdgiltselalsl........dllpklvvvigggaig
00447051   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00455181   1/1  ilAtGalslplll.........................................................
00472712   2/2  kgkdvvviGgGpaGleaAlalarlglkvtllerrprlggtl.............................
00483561   1/1  l...........gggllgvdelaellpllgsevtgglrsprggtvdparlvralaea.............
00496792   2/2  rgkdvvviGgGpaGleaAlylarlglkvtlierrdrlggd..............................
00488661   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00476821   1/1  ....glgwsyeellpyfkkaekllgvlgalr.........kllvvigggaiglglalvl........---
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00396641   1/1  .ilatgappavleleglgvpflrtsdgaldlkgglvavigggsiarela.....................
00482001   1/2  ----------------------------------------------------------------------
00472762   2/2  pgkkvaviGaGgvGlalAlalaaagaagevtlvDideekleglardlldilellgv....glvvttdlee
00445592   2/2  -pkkvaviGaGgvGlalAlllaaagggdVtlvDidpekleglaadlldilelllverlitttdleealad
00376431   1/2  ----------------------------------------------------------------------
00461281   1/1  ........gwgydellpyfkvaedglgltadaiiiatgsrprypgipgplsvswal--------------
00380741   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00363012   2/2  agkrvvvvGgGlaGleaAaalrrlglevtlvergdrlllpyl............................
00425342   2/2  kgkkvaviGaGliGlalalllallglgeVvlyDinpekleglaadladilelllvkgrirattdlyealk
00533831   1/2  ----------------------------------------------------------------------
00484141   1/1  kgktvliiGaGgvGlaiaqalaalGakkVvlvdrdeekaqalv---------------------------
00465791   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00374372   2/2  pgkrvlViGaGgiGleaAaalarlGakVtvvd......................................
00504432   2/2  eikkvaviGaGlmGlgiAavlaraGleVvlvdinpealeraldeiaklllklvlkgllvelllgaalari
00481022   2/2  --lllmlkmmkiaviGaGavGtalAallaengheVtlwdrneekvellnekgenpiylpglelpenltat
00454812   2/2  kgkrVvViGaGlsGlaaarlllrlGaevtvldrrdrpggllllelgvefvl-------------------
00533832   2/2  ---lellgvallevlgkrilkgkkvaviGaGgvGlalAllll----------------------------
00529642   2/2  kgkrVvViGaGaSgldialelakvaksvtllersdelggpw.............................
00419401   1/2  ----------------------------------------------------------------------
00531722   2/2  kgakVaviGaGgvGlalAllLalagvagevvlvDidevklsn----------------------------
00472702   2/2  ledllldllsmstkkdvvviGaGpaGleaAlalarlglkvtlierglGgtllnggpglskpll.......
00366542   2/2  .pkdvvviGgGpaGleaAaalarlgakvtvvergdrlggtld............................
00447052   2/2  rllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlylarlgakvtlierrdrlggtl
00472782   2/2  pgkkvvviGaGpvGlalAlalallgavgkVvlvdideekleglalelidillpklvdvvvttelkevlkg
00363011   1/2  ----------------------------------------------------------------------
00466732   2/2  kikkvaViGaGlmGsgiAavlaaaGikVvlvDidpealekalkrilklleklvklgllsaaealllllea
00479922   2/2  -pkkvaviGaGavGlalAlalaraGaageVvlvdrdeerlealaadledllellgvdlra....ttdlee
00485852   2/2  --mKiaviGaGnvgsalalllalagladelvlvDideekleg----------------------------
00384492   2/2  --lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlglkvtvver.drlggtldcilskall
00457182   2/2  --mKiaviGaGyvGlslalllalkgladevvlvDideekleglaldlsdileplle.....vlittdlye
00472761   1/2  ----------------------------------------------------------------------
00423422   2/2  rgkdvlviGgGdvGlaaarllleagakvtvve--------------------------------------
00480092   2/2  --ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld......
00355352   2/2  -GkkvaviGlGsmGlalAallaaaGheVlvwdrdpekveelaelgapvakylpglellgrlrattdleea
00475652   2/2  .pkdvvviGgGpaGleaAlalarlgakvtvvereprlggtld............................
00512132   2/2  -mkkvaiiGaGyiGlslalllaekgllgkvvlvDiseerleglaldlldalli-----------------
00533222   2/2  .pkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld............................
00353162   2/2  kgktvaivGfGniGravarlllealgakvvavsdskgaly------------------------------
00445591   1/2  ----------------------------------------------------------------------
00488662   2/2  dlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlgakvtlvergdrlggtlld.....
00509612   2/2  ---lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlglkVtliergdrl
00482002   2/2  --llpipglevltsdgaldllelpkdvvviGgGpaGleaAlalarlglkvtlvergdrlggtl.......
00376432   2/2  -eydvvvvGaGpaGlaaAlalaraglkvlllekgprlggllv............................
00472781   1/2  ----------------------------------------------------------------------
00406512   2/2  --mhviiiGlGrvGlalarlLlelgidvvvidideerveelrelgvlvvv--------------------
00463572   2/2  --mKiaviGaGyvGlelAavla.lgheVtlvdinpeklealnegllpilelgldelveellgnltattdl
00363002   2/2  ekydvvviGaGlaGlsaAlelaragldvtvlergprlggcll............................
00423402   2/2  lavllaalllcrflgglgllltlagglagkkvlviGaGgvGlaaarllaal-------------------
00480272   2/2  --mhviiiGlGrvGrlvarlLlelgidvvvidldpervellae---------------------------
00509602   2/2  --kdvvviGgGpaGleaAlalar.glkvtliergdrlggtrpllsgvipgkll.................
00501482   2/2  ---lmeleydvvviGgGpaGlaaAlylaraglkvtliekgplllyalgglllyvgcilskall.......
00354052   2/2  kpmkvlvtGAaGfiGyalalllaaggladldllvelvlldiveeyale----------------------
00455192   2/2  --ppipgvellltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtlierrdrllgtl.......
00485842   2/2  --rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAlalarlgakvtvvergdrllgtld..
00480452   2/2  --pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtlverrdrlgglld.......
00463442   2/2  --krVlVvdgGgGpaGleaAealarrGheVtlvealdrlggll...........................
00425341   1/2  ----------------------------------------------------------------------
00479921   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00380742   2/2  keydvvviGgGpaGlaaAlrlaraGlkvlllekgdlgggclnvgcipgkrllaaaelydelrelleelgi
00368892   2/2  --ppipglellltsddalellelpkdvvviGgGpaGleaAlalarlglkvtliergdrlgglld......
00484541   1/2  ----------------------------------------------------------------------
00482272   2/2  --mkiaviGaGyvGlplAallaeaGheVvgvDideekvealndgil------------------------
00483652   2/2  kpkdvvviGgGpaGleaAlalarlGakVtviergdrlggrlld...........................
00531721   1/2  ----------------------------------------------------------------------
00419402   2/2  --lPdipglelvltsddalelkepkkvvviGgGyiGleaAsalrrlgaevtliergdrllpll.......
00469732   2/2  ddalalkelpkdvvviGgGyiGleaAaalarlgaevtlvergdrllpyldcelskall............
00469722   2/2  --dlpgvellltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtliergdrllglldpelskal
00354772   2/2  lkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrsealealegv------------------
00484542   2/2  ---mmkklkvaiiGaGniGlalaral--------------------------------------------
00460572   2/2  --pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlErgdrpggtsgtnggllaaglvapllllpggip
00423421   1/2  ----------------------------------------------------------------------
00354771   1/2  ----------------------------------------------------------------------
00483642   2/2  --ydvviiGgGpaGltaaiylarlgpdlkvtliek...ggtclyvgcllskalg................
00504431   1/2  ----------------------------------------------------------------------
00482271   1/2  ----------------------------------------------------------------------
00354051   1/2  ----------------------------------------------------------------------
00477122   2/2  ---ektdVaIvGAGpaGlaaAlaLaraGldvtvlErrdrpggta.lgrggalsprglelleelglldall
00355351   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00467612   2/2  --gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpegakvtlvergdrllpcld.......
00463571   1/2  ----------------------------------------------------------------------
00481082   2/2  aalliliaslglellpadylvlaigssdgaldlpklp---------------------------------
00481021   1/2  ----------------------------------------------------------------------
00457181   1/2  ----------------------------------------------------------------------
00461562   2/2  ----------------------------------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00512131   1/2  ----------------------------------------------------------------------
00353161   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00485851   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00480162   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DHSDTIEVIVNPEDIDYDAASEQARRDSKSQDLVCQTLESYAMRDPKGAPHKLFIHFFESPVEILGEDGK
00480161   1/2  pkelrell................................................eegveflfladpve
00461561   1/2  atpeelralle................................................egvelllltsp
00360162   2/2  lggllrygippdpl..dlallelelellpraldrlvellldlllelpdlllllallaeeegvefrfgvsp
00406192   2/2  lpelggllrygipedkllkeflareiad.lplrrlleellayllevadaeelgveilfgttvveilg.dg
00529631   1/1  plykhlfpp-------------------------------------------------------------
00471411   1/1  vellee.egvei----------------------------------------------------------
00503641   1/1  ......................................................................
00364591   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00374411   1/1  laealarllkilgaevtllersd...............rllallddegqvd...................
00488071   1/1  ----------------------------------------------------------------------
00435771   1/1  lld.................alalllgllsldalaalepllale.........................l
00526001   1/1  ......................................................................
00492221   1/1  ----------------------------------------------------------------------
00509271   1/1  ......................................................................
00467501   1/1  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00457971   1/1  ......................................................................
00499901   1/1  ............................................................dgvldpkggl
00491501   1/1  ggaiglelalalarlgaevtlversp............................................
00406191   1/2  ----------------------------------------------------------------------
00462741   1/1  viGggasglelasalar.....................lgakvtllersgrllppggl............
00529261   1/1  ......................gfigledargllrlgagvtvvdrgd...................llra
00485831   1/1  ----------------------------------------------------------------------
00400351   1/1  .................................pgdglldggdgalvaalaealer..lgve....illg
00458701   1/1  ...................................................................rlg
00488651   1/1  ----------------------------------------------------------------------
00484941   1/1  llllglllllllll........................glspdhligagplrggcdyrgggvfgcpggag
00520321   1/1  .....................................................alaeaaeel.Gveiltg
00470681   1/1  ----------------------------------------------------------------------
00533211   1/1  ...........................................ellrallealee..lgve....irlgt
00440981   1/1  ......................................................................
00470221   1/1  rdrlllffppdgqvdpaglvralaealeal........................................
00458811   1/1  eklltlviiGgGn.........................................................
00475641   1/1  ----------------------------------------------------------------------
00359891   1/1  ........................................................aaeelpgveillgt
00400491   1/1  ....................................................aealealpgveillgtev
00360921   1/1  sgvelasalarlgagvtvv...................................................
00384682   2/2  ...........................................fpafpelvellkeegveillgtavlei
00490031   1/1  .....................................................................a
00406021   1/1  .............................................eaaeelgveiltgtevtei...dg.
00464461   1/1  ......................................................................
00467601   1/1  ..............................................daelaaalaelleklgvevllgt.
00462701   1/1  ......................................................................
00424461   1/2  ----------------------------------------------------------------------
00464161   1/1  ........................................eelaaalaealeelgveillgtevt.i.ed
00509601   1/2  ----------------------------------------------------------------------
00471331   1/1  ..............................................pellkallealekl..gv.illgt
00486071   1/1  ----------------------------------------------------------------------
00481991   1/1  ......................................................................
00457951   1/1  ...............................lladgvtgglrpdggrvdparlvrallealeelGveil.
00529111   1/1  ----------------------------------------------------------------------
00406881   1/1  ................................................plllrvlgaelaaalaealeel
00473271   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00413411   1/1  ..........................................lvgrgdgaalaralaeaaealgveiltg
00501481   1/2  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00479092   2/2  .....................................pelallllelleklgvevllgtrvteiakeylp
00465141   1/1  .....................................................gaelaaalaealeelgv
00533221   1/2  ----------------------------------------------------------------------
00424462   2/2  kllglealllrllllllglglllpipgrvlpkellealaealek......lgveillgtevtsidrdggg
00472701   1/2  ----------------------------------------------------------------------
00470291   1/1  lelapvlarlg...........................................................
00447051   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00455181   1/1  ......................................................................
00472712   2/2  .........................................dlllelleklgveillgtevteidgdggg
00483561   1/1  ........................................................aeelGveillgtev
00496792   2/2  .....................................pelleyllelleklgveillgtevteiegdgdg
00488661   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00396641   1/1  ......................................................................
00482001   1/2  ----------------------------------------------------------------------
00472762   2/2  alkgaDvviia-----------------------------------------------------------
00445592   2/2  aDvviiavgtprkpgmlrldlladnlgi------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00363012   2/2  .....................................................rpelskallelleelgv
00425342   2/2  ..gaDvviiavg.vprkpgliaellkrgdllvtnasilv..diiealaklapdaivlvvsnPvdimtlva
00533831   1/2  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00374372   2/2  .........................................rrpellerleelgakfvlltld.eelvev
00504432   2/2  tgttdleal.....adadlVieavpenldvklavlaeleallkpgailasntsslsitaladalgrpgrv
00481022   2/2  t.dleeavkda-----------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00529642   2/2  ...................................................................lgv
00419401   1/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00472702   2/2  ......................................................................
00366542   2/2  ......................................................pelskallelleklgv
00447052   2/2  ......................................................................
00472782   2/2  aDvvilatgaprlpgalrldlvetnldiv-----------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00466732   2/2  llgritattdladaladadlvi------------------------------------------------
00479922   2/2  alkdaDlviiavgvp.....lkpglvrld...lasnnsgividvlaallklppdvivlvvsnPvdlmelv
00485852   2/2  ----------------------------------------------------------------------
00384492   2/2  ......................................................................
00457182   2/2  alkdadvviiavgtprkpgmsrd-----------------------------------------------
00472761   1/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00480092   2/2  ......................................................................
00355352   2/2  ladaDvvilavptpavrsvlaelapllkpgaivvdlstglvgtieallaallegvlalagld--------
00475652   2/2  ......................................................pelskallelleklgv
00512132   2/2  ----------------------------------------------------------------------
00533222   2/2  ......................................................eelslallelleklgv
00353162   2/2  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00488662   2/2  ......................................................................
00509612   2/2  gg.ld.................................................................
00482002   2/2  ......................................................................
00376432   2/2  ........................................glipskllllrvlgaelaaalaealeelgv
00472781   1/2  ----------------------------------------------------------------------
00406512   2/2  ----------------------------------------------------------------------
00463572   2/2  eealkdaDlvi-----------------------------------------------------------
00363002   2/2  ...........................................llsvpggrldpeelvlalaelleelgv
00423402   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------
00509602   2/2  .................................................................deela
00501482   2/2  ......................................................llgilgeellarlreq
00354052   2/2  ----------------------------------------------------------------------
00455192   2/2  ......................................................................
00485842   2/2  ......................................................................
00480452   2/2  ......................................................................
00463442   2/2  .......................................................rlgipdpllerleel
00425341   1/2  ----------------------------------------------------------------------
00479921   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00380742   2/2  pfdevllgllll......................................................lgrg
00368892   2/2  ......................................................................
00484541   1/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00483652   2/2  ......................................................eelalallelleklgv
00531721   1/2  ----------------------------------------------------------------------
00419402   2/2  ......................................................................
00469732   2/2  ......................................................................
00469722   2/2  l.....................................................................
00354772   2/2  ----------------------------------------------------------------------
00484542   2/2  ----------------------------------------------------------------------
00460572   2/2  llalalealdllrelglelgidf...rvgalvlatglaela....dalllalgapprlldapelrellpv
00423421   1/2  ----------------------------------------------------------------------
00354771   1/2  ----------------------------------------------------------------------
00483642   2/2  ................................................llglldeelalrllelleklgv
00504431   1/2  ----------------------------------------------------------------------
00482271   1/2  ----------------------------------------------------------------------
00354051   1/2  ----------------------------------------------------------------------
00477122   2/2  argvpldglvvvdgggrlaldfaelalgapgyvvdraellralleaaeel..gve....irlgtrvtsil
00355351   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00467612   2/2  ......................................................................
00463571   1/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00457181   1/2  ----------------------------------------------------------------------
00461562   2/2  ----------------------------------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00512131   1/2  ----------------------------------------------------------------------
00353161   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00485851   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00480162   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VVGLKTERTQLDGNGGVTGTGEFKTWDVQSVYRAVGYRSDAIEGVPFDDERAVVPNDGGHIIDPEVGSPI
00480161   1/2  id.gdgrvvgvelvd............geekvleadl---------------------------------
00461561   1/2  veil.gdgrvvgvvlv............dgeekvlpa---------------------------------
00360162   2/2  veilgdddlgrvtgvrlarteldasgrrkpvpvtgee---------------------------------
00406192   2/2  rvtgvrlvrvelvtddidgrr.vvitgdgetlpadlv---------------------------------
00529631   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00503641   1/1  .....................................---------------------------------
00364591   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00374411   1/1  ..................prglldalaealeell.....gveirlgtrvteierdgggvt.vtl......
00488071   1/1  ----------------------------------------------------------------------
00435771   1/1  lggllypdggpaalvealaealegveillgtrvteierdgggvt.vttedadgslkpv.ledge..tiea
00526001   1/1  .vergglllpgdgvgdraslaralleaaealgveiltgtrvteilrdedggrvtgVetrdl.........
00492221   1/1  ----------------------------------------------------------------------
00509271   1/1  ......................................................igvrp.ntegllleda
00467501   1/1  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00457971   1/1  ..................................................vllaigrrpn.tellglega
00499901   1/1  gallealleelgveil.lgtpvtei................Ge...leadavvlatgldp.laellgle.
00491501   1/1  .....................rlgpvlpaglsealaealeall.....Gveirlgtrvteierdgggvt.
00406191   1/2  ----------------------------------------------------------------------
00462741   1/1  .............---------------------------------------------------------
00529261   1/1  laeaaeel..Gve....irlgteVtsierdedgrvtgVttedme......plkdGeekpvpveGetirad
00485831   1/1  ----------------------------------------------------------------------
00400351   1/1  trvteilrdgggvtgVttedgel......eldgeevtiradavvlatGarssprllllsgigpaellkal
00458701   1/1  lltprggygalvealakalendylealarlgveirlgtrvteilrdgggvtvttadGe..tieadavvla
00488651   1/1  ----------------------------------------------------------------------
00484941   1/1  lvlggrgslaeallealeelp.....GveirlgteVteiegdgggvt.Vtted............Gee..
00520321   1/1  tevteierdggrvtgVtv..........rdtadGeeetiradlvvlatGarsnvrllglsglglpgdgya
00470681   1/1  ----------------------------------------------------------------------
00533211   1/1  .vtei...dggvvgvtled............GeeetleadlvvlatGsvvrlllgvrpn.legllleglg
00440981   1/1  .............................................................ealglelde
00470221   1/1  ................................lgveirlgtrvteierdgggvt.Vttad..........
00458811   1/1  ................................................dpgklaralaealekrlGveir
00475641   1/1  ----------------------------------------------------------------------
00359891   1/1  evteilgdgdgvtvttgrvtgvvlrdl.........adGeevtiradlvvlatGarsnllllllsgigpt
00400491   1/1  tellgdggrvtgvvledge.........tgeevtiradavvlatGgrpnlellltnppgntgdglaller
00360921   1/1  ............................yrpdggrgalaralaraaeaagvtvltgtrvteierdggggr
00384682   2/2  lgddgkvtgvrvvrveldesgrvvvvtgegetleada---------------------------------
00490031   1/1  aeelgveillgtrvtellvdeggrvtgvvl..........edadGeevtiradavvlatGgfpn.lrrll
00406021   1/1  vvgvvled............GeeltieadlvvlatGarsnlrlllgldlpkelleglgleldtrggivvd
00464461   1/1  ....aaeelgveillgtrvteilvdeggrvtgvtt..........edadGeeltiradavvlatGgfpn.
00467601   1/1  vteiegddgrvtgvvvvrle.........dge..tleadlvilatGglslllllgrrpntellgleaagl
00462701   1/1  ...aaeelgveillgtrvteilvdeggrvtgvtlr..........dadGeevtiradavvlatGglsn.l
00424461   1/2  ----------------------------------------------------------------------
00464161   1/1  grv.gvtled............geeltleadlvilatGrrslPlllpnt.ellgleklgvelderggilv
00509601   1/2  ----------------------------------------------------------------------
00471331   1/1  ..veilgddggv.gvt............ledGeeetieadlvvlAtGglsrvrlllvrpntellglealg
00486071   1/1  ----------------------------------------------------------------------
00481991   1/1  ......................dgeelaaalaelleelgvevllgtav..iiddgtvtvdge..tieadl
00457951   1/1  lg.evteierdg...........dGe.....adlvvlAtGarsplllkl......pllpvrgqilvlepl
00529111   1/1  ----------------------------------------------------------------------
00406881   1/1  gveillgtavve..dggrvtldge..tieadlvvlAtGarsllllgrrpntellllelagleldrggivv
00473271   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00413411   1/1  tevteilrdeggrvtgVvtadt.........kdGeevtiradavvlatGafsn...lrlllglglgltgd
00501481   1/2  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00479092   2/2  elllgveveagdgvvtvv.lgdgetieadlvilAtGarpn....nlllpglalaldkggilvnvvdrtsl
00465141   1/1  eillgtrvteidggvvgvttedg..etieadavvlAtGarslllllgrrpntellglegaglelderggi
00533221   1/2  ----------------------------------------------------------------------
00424462   2/2  vt.v...............tgdggtleadavvlAtGar--------------------------------
00472701   1/2  ----------------------------------------------------------------------
00470291   1/1  ...............akvtgvgrlprg.lpvgdgglsalvaalakalerlgveiltntrvtrilvdgggg
00447051   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00455181   1/1  ......................................................................
00472712   2/2  vtgvtledgl.........dgeeetleadavilatGf---------------------------------
00483561   1/1  tsierdgg.vvgVtt......edG.........eiradlvvlAtGawspellkllgielplgllpvrgqi
00496792   2/2  vtgvtledge........ltgeeetleadaviiatG----------------------------------
00488661   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00396641   1/1  ..laeaalk..lgveilegtevtellgdgdgkgrvtgvvtkdlk.........tgevgtiradavvlatG
00482001   1/2  ----------------------------------------------------------------------
00472762   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00363012   2/2  elrlgtevtsidrdgvvlddgt..tleadllvlAtG----------------------------------
00425342   2/2  lklsglpsrrvi----------------------------------------------------------
00533831   1/2  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00374372   2/2  vlaltvdvsdeegrlkavetleellgeaDvvivaagippataplllteellelm.......kp-------
00504432   2/2  iglhffnpvplm----------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00529642   2/2  villnteveevtgdg.vvledgtelleaDavilA------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00472702   2/2  .....lrvlgpelaeylrelleklgveillgtrvtsidrdgdtgrvtgvtledg..etleadavvlAtGa
00366542   2/2  evllgtevtaidvdgdgvtvtvldvvlgdgetlea-----------------------------------
00447052   2/2  .................dlllelleklgveillgt-----------------------------------
00472782   2/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00466732   2/2  ----------------------------------------------------------------------
00479922   2/2  elilgllpskrvig--------------------------------------------------------
00485852   2/2  ----------------------------------------------------------------------
00384492   2/2  ............elleelgvevllgtevteveldgg----------------------------------
00457182   2/2  ----------------------------------------------------------------------
00472761   1/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00480092   2/2  ......eelsllllelleklgvelllgtrvtaidvd----------------------------------
00355352   2/2  ----------------------------------------------------------------------
00475652   2/2  elllgtevtaidgdgdgvvvvlllvdvvlgdget------------------------------------
00512132   2/2  ----------------------------------------------------------------------
00533222   2/2  elllgtrvtaidvdgdgvtvtledggeeetleadlv----------------------------------
00353162   2/2  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00488662   2/2  ......eelaaallelleklgvevllgtrvtaidvd----------------------------------
00509612   2/2  .................pelskallelleklgvelllg--------------------------------
00482002   2/2  .....dpelsklllelleklgvevllgtevtaiegd----------------------------------
00376432   2/2  evllgtevtsidrdgggvtgvllvttgdgetiradavvlAtGarpntp...lleglglelderggivvde
00472781   1/2  ----------------------------------------------------------------------
00406512   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00363002   2/2  evrlgtevtsidrdgdgvtledge..tleadavvlAtGar.prvlllpglellegagleld..ggivvde
00423402   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------
00509602   2/2  eylrelleklgvevllgtevtsidgdgkgvtlddge.leadavvlatGsr.pntpllp....glelderg
00501482   2/2  leklgveillgtrvtsidldggtvvltdgetieadavilAtGvlvaigrrpntellkl.glelderggiv
00354052   2/2  ----------------------------------------------------------------------
00455192   2/2  .....dpelskallelleklgvevllgtevteidgdg........etleadavliAt-------------
00485842   2/2  ..........pelsklllelleklgvdlllgtkvtai---------------------------------
00480452   2/2  .....pelaaallelleklgvelllgtrvtaidldg----------------------------------
00463442   2/2  gveillgvavteilgdgvel..geeleleaDlvvlatgftpndel...................dealrt
00425341   1/2  ----------------------------------------------------------------------
00479921   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00380742   2/2  gadgaelaaalaelleelgvevllgtavt.i.ddgrVtldge..titadavilAtGarprllglpgitpt
00368892   2/2  ......pelaaallelleklgvevllgtevtaid------------------------------------
00484541   1/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00483652   2/2  elllgtevteidgdgggvvvltdgetleadlvvlA-----------------------------------
00531721   1/2  ----------------------------------------------------------------------
00419402   2/2  .....deelsllleelleelgidvllgtevteiek-----------------------------------
00469732   2/2  elleklgvdlllgtkvtaidrdddgvlvvvledg.e----------------------------------
00469722   2/2  .............elleklgvelllgtevtaidldg----------------------------------
00354772   2/2  ----------------------------------------------------------------------
00484542   2/2  ----------------------------------------------------------------------
00460572   2/2  vvpgggvvdpaallealaeaaeelGveirlg..rvtsi.......dG..........etleadlvvlatG
00423421   1/2  ----------------------------------------------------------------------
00354771   1/2  ----------------------------------------------------------------------
00483642   2/2  elllgtevtsidlegktvtllllvlgdgetleydklvlAtGarpvvvaigvtpntgllkaglelderggi
00504431   1/2  ----------------------------------------------------------------------
00482271   1/2  ----------------------------------------------------------------------
00354051   1/2  ----------------------------------------------------------------------
00477122   2/2  eedgdgvtvtledg...........geeetieadlvvgAdGarsrvrrllgip.................
00355351   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00467612   2/2  .....pelsklllelleklgvdvllgtevtaidvddk---------------------------------
00463571   1/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00457181   1/2  ----------------------------------------------------------------------
00461562   2/2  ----------------------------------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00512131   1/2  ----------------------------------------------------------------------
00353161   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00485851   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00480162   2/2  ---------------------------------------------------------------------l


                         -         -         -         -         *         -         -:420
query           TGLYATGWIKRGPIGLIGNTKSDAKETTEMLLADHAAGSLPAPAKPELESIIEFLDERKVAFTTWDGWHL
00480161   1/2  ----------------------------------------------------------------------
00461561   1/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00374411   1/1  ....edgdgeeetieadlvvlatGarsltellgl------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00435771   1/1  davvlatGars.larllldpplppvrgqalp..t------------------------------------
00526001   1/1  adGeeftiradlVvlaaGaipsprllllsGigl.....pev-----------------------------
00492221   1/1  ----------------------------------------------------------------------
00509271   1/1  glelderggilvdetlrtsvpglyaaGdvaggp.glaavAlaq---------------------------
00467501   1/1  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00457971   1/1  gleld.rggivvdetlrtsvpgiyaaGdvag.gpkla---------------------------------
00499901   1/1  ....lperglivvdpglrtgvpglylaGdaagpggpgvtgaiasgrlaa---------------------
00491501   1/1  vttedGd...........geeetieadavvlatG------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00529261   1/1  lvvlAtGarss.prlllleglgle.dgrgyipvdlpllertsvpgvfaaGDaahgvhplggqGinlale-
00485831   1/1  ----------------------------------------------------------------------
00400351   1/1  ...gielpldlpgvgenlidhptggllarmgtpdggivvdpt----------------------------
00458701   1/1  tgarp.laellgllgpe..lpergiiavdglpvgsllkvh------------------------------
00488651   1/1  ----------------------------------------------------------------------
00484941   1/1  ieadlVilatGarssl....rlledsglppderg------------------------------------
00520321   1/1  lairvgeplpdh----------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00533211   1/1  lelderggivvdetlrtsvpgvyaaGdaaggp.klavvAlasGrvaaen---------------------
00440981   1/1  rggivvdetlrtsvpglyaaGdvaggpgplavtA------------------------------------
00470221   1/1  ..Ge..tieadlvvlatGarsl.lrllglpglgleldpagerlpdgWgggipvdpdlrtgvpglylaGda
00458811   1/1  lgtevteierdeggrvt.vtte..........dgetkdvl------------------------------
00475641   1/1  ----------------------------------------------------------------------
00359891   1/1  gdglalleraglelvderggivvdeglrtsvpgl------------------------------------
00400491   1/1  aglel..hdtrgg---------------------------------------------------------
00360921   1/1  vtgVtledge.......gltgeevtiradlvvlaaG----------------------------------
00384682   2/2  ----------------------------------------------------------------------
00490031   1/1  gldlpllpvrgtalalgatgdglalleragvelddrgfvqff----------------------------
00406021   1/1  etlrtsvpglyaaGdaa.gpgqgvatalasGrl-------------------------------------
00464461   1/1  lalllglglpphPdgrllfgprdddellrllpglgvalia------------------------------
00467601   1/1  elderggivvdetlrtsvpgiyaaGDvagg.prlaavAla------------------------------
00462701   1/1  rlllglglPifPdgrlllgprpddelrellpglgval---------------------------------
00424461   1/2  ----------------------------------------------------------------------
00464161   1/1  detlrtsvpglyaaGdvagg.grlavvaiaeGrl------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00471331   1/1  leldierggilvdetlrtsvpgvfaaGdavhgapplavvAl-----------------------------
00486071   1/1  ----------------------------------------------------------------------
00481991   1/1  vilAtGar.prlpplpggrrpnte..lleaagle------------------------------------
00457951   1/1  atdlpgvfvigdptggngllvggtaelggldldldp----------------------------------
00529111   1/1  ----------------------------------------------------------------------
00406881   1/1  detlrtsvpgvyaaGdaagg.grgaavAiasGr-------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00413411   1/1  glalalrlgaplpdggflqfhPthytmggivvdpdlrtsvpglyaaGdaagpglhganplggngla----
00501481   1/2  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00479092   2/2  pdvya-----------------------------------------------------------------
00465141   1/1  vvdetlrtsvpglyaaGdaagg.gglvatAiasGrlaaeai-----------------------------
00533221   1/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00470291   1/1  glr-------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00455181   1/1  ..........glspntpgllleglgielderggivvdenlr-----------------------------
00472712   2/2  ----------------------------------------------------------------------
00483561   1/1  lvv......dpglfaigd----------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00396641   1/1  gagnlll---------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00472762   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00533831   1/2  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00504432   2/2  ----------------------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00472702   2/2  rsn..pnilglegagllderggivvdetlrtsvpgvfaaGdv----------------------------
00366542   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00466732   2/2  ----------------------------------------------------------------------
00479922   2/2  ----------------------------------------------------------------------
00485852   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00457182   2/2  ----------------------------------------------------------------------
00472761   1/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00512132   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00353162   2/2  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00376432   2/2  tlrtsvpglyaaGdaaggvnplagvAlasGrlaalniagyl-----------------------------
00472781   1/2  ----------------------------------------------------------------------
00406512   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00363002   2/2  ylrtsvpgvyaaGdvagvplpllglggggglaav------------------------------------
00423402   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------
00509602   2/2  gilvdetlrtsvpgvfaagDvagkpv.lvvgagaegrl--------------------------------
00501482   2/2  vdelllrtsvpgvfaaGdvaggplrlavvAvae-------------------------------------
00354052   2/2  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00463442   2/2  svpgvfa---------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00479921   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00380742   2/2  llleaagvelderggivvdetlrtsvpglyaaGdva.gggr-----------------------------
00368892   2/2  ----------------------------------------------------------------------
00484541   1/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00531721   1/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00354772   2/2  ----------------------------------------------------------------------
00484542   2/2  ----------------------------------------------------------------------
00460572   2/2  ags..rellg...dlg------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------
00354771   1/2  ----------------------------------------------------------------------
00483642   2/2  vvdetlrtsvpgiyAaGDvagvpglllgllllpklaavA-------------------------------
00504431   1/2  ----------------------------------------------------------------------
00482271   1/2  ----------------------------------------------------------------------
00354051   1/2  ----------------------------------------------------------------------
00477122   2/2  ...........prtsvgr----------------------------------------------------
00355351   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00457181   1/2  ----------------------------------------------------------------------
00461562   2/2  ------Ggalrlldgvigntaldvartlarlgakvtlverrglllpatpeelralleegvelllltspve
00406511   1/2  ----------------------------------------------------------------------
00512131   1/2  ----------------------------------------------------------------------
00353161   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00485851   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00480162   2/2  dglyllgllargkrvvviGggntaldvartllrlgasvtlverrgrllapaspkelrelleegveflfla


                         -         -         +         -         -         -         -:490
query           LDAAERALGEPEGRERKKIVEWNDMVRHARPEYDI-----------------------------------
00480161   1/2  ----------------------------------------------------------------------
00461561   1/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00470221   1/1  a---------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00481991   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00501481   1/2  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00472762   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00533831   1/2  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00504432   2/2  ----------------------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00466732   2/2  ----------------------------------------------------------------------
00479922   2/2  ----------------------------------------------------------------------
00485852   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00457182   2/2  ----------------------------------------------------------------------
00472761   1/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00512132   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00353162   2/2  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00406512   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00354052   2/2  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00479921   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00484541   1/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00531721   1/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00354772   2/2  ----------------------------------------------------------------------
00484542   2/2  ----------------------------------------------------------------------
00460572   2/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------
00354771   1/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00504431   1/2  ----------------------------------------------------------------------
00482271   1/2  ----------------------------------------------------------------------
00354051   1/2  ----------------------------------------------------------------------
00477122   2/2  ----------------------------------------------------------------------
00355351   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00457181   1/2  ----------------------------------------------------------------------
00461562   2/2  ilgdgrvvgvvlvdgeekvlpadlvil-------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00512131   1/2  ----------------------------------------------------------------------
00353161   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00485851   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00480162   2/2  dpveidgdgrvvgvelvdgeekvlea--------------------------------------------