[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55698.1


[Show Plain Result]

## Summary of Sequence Search
   1::266
   1::266  2.4e-59 38.0% 0046590 00465901 1/1   n-nitrogen hydrolase                    
   1::266  6.9e-59 38.2% 0037433 00374331 1/1   n-nitrogen hydrolase                    
   1::268  7.4e-56 37.4% 0037148 00371481 1/1   n-nitrogen hydrolase                    
   1::262  1.3e-55 36.6% 0039340 00393401 1/1   n-nitrogen hydrolase                    
   1::266


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVKELA
00465901   1/1  lmmdtlrvalvQlnplgdleanlakalelieeaaaqgadlvvlPElfltgypledlllelaepldgpale
00374331   1/1  llsllmmdtlrvalvQlnpvlgdleanlakalelieeaaaqlpgadlvvfPElfltgypledlllrlael
00371481   1/1  mrtvrvalvQlnpvlllgdleanlekalalieeaaaqgadlvvfPElfltgyppedllldpalllaelae
00393401   1/1  tlrvAlvQlnpvvgdleanlekilelieeaaaqgadlvvfPElfltgypfedlllrlallaealdgpale


                         -         -         *         -         -         -         -:140
query           DELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFE
00465901   1/1  alaelakelgivivagsierlpl....ddggklyntavvidpdGeivgryrKlhlfpfgeyvplgflesr
00374331   1/1  aepldgptlealaelarelgvvlvvGsierlpedgg.....rlyNtavlidpdGeilgryrKlhlfpfge
00371481   1/1  tldgpalealaelarelgivvvvGlperlle....sdggklyNtavlidpdGeilgryrKlhlfdygefd
00393401   1/1  alaelarelgivvvvgsperdgg........rlyntavlidpdgilgryrKlhlp....fgErryftpgd


                         +         -         -         -         -         *         -:210
query           VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARL
00465901   1/1  yftpGdgglvvfdtpggkiglliCyDlrfpelaralalqgadlllvpsawpwftgp.aqwllllrarAie
00374331   1/1  ylplgfderryftpGdglvvfdtpggkigvliCyDlrfpelaralalqgadlllvpaawpwflgp.lqwl
00371481   1/1  PllkptylErryftpGdgglvvfdtpggriglliCyDlrfpelaralalqGaeillvpsawpsflgkldl
00393401   1/1  gglvvfdtpggriglliCyDlrfpelaralalqgaelllvpsas..gy...aqwllllrarAiengcyvv


                         -         -         -         +         -         -         -:280
query           PEELRDKRNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPVL--------------
00465901   1/1  ngcyvvaanrvgih......edglvfyGhSaivdpdGevlaeageeegllvadldl--------------
00374331   1/1  lllrarAiengcyvvaanrvgt......egdllvftGhSaivdpdGevlaelgeee--------------
00371481   1/1  rlltgpahwllllrarAiengcyvvaanrvgtedgl.......vfyGgSaivdpdGev------------
00393401   1/1  aanrvggedg.......lvfyGgSaivdpdGevlaelglfeegllvadidld------------------