[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55730.1


[Show Plain Result]

## Summary of Sequence Search
   1::441
   2::441  5.6e-40 31.2% 0047971 00479711 1/1   pendent exopeptidases                   
   1::441  9.3e-37 31.5% 0050200 00502001 1/1   pendent exopeptidases                   
   3::442  1.2e-34 31.0% 0048899 00488991 1/1   pendent exopeptidases                   
   2::442  2.3e-32 32.7% 0046134 00461341 1/1   pendent exopeptidases                   
   3::440  3.3e-32 31.6% 0050176 00501761 1/1   pendent exopeptidases                   
   4::441  3.4e-32 29.0% 0046827 00468271 1/1   pendent exopeptidases                   
   4::442  6.6e-30 27.9% 0051762 00517621 1/1   pendent exopeptidases                   
   2::443  2.8e-28 30.5% 0051389 00513891 1/1   pendent exopeptidases                   
   3::441  5.8e-26 31.9% 0050182 00501821 1/1   pendent exopeptidases                   
   9::441  8.1e-24 28.9% 0052787 00527871 1/1   pendent exopeptidases                   
   4::234  5.2e-23 27.0% 0046310 00463101 1/1   pendent exopeptidases                   
   4::442  1.7e-20 32.2% 0052940 00529401 1/1   pendent exopeptidases                   
   4::439  2.2e-19 25.5% 0049240 00492401 1/1   pendent exopeptidases                   
   5::440  1.7e-18 29.4% 0050184 00501841 1/1   pendent exopeptidases                   
   6::441  6.1e-18 28.7% 0051343 00513431 1/1   pendent exopeptidases                   
   5::441    1e-17 29.9% 0050951 00509511 1/1   pendent exopeptidases                   
 194::351    3e-15 24.1% 0046135 00461351 1/1   rial exopeptidase dimerisation domain   
  79::441  6.3e-14 27.2% 0051172 00511721 1/1   pendent exopeptidases                   
   3::440    9e-14 24.0% 0053284 00532841 1/1   pendent exopeptidases                   
  61::443  3.6e-13 24.5% 0051474 00514741 1/1   pendent exopeptidases                   
 195::344  6.6e-13 28.2% 0050177 00501771 1/1   rial exopeptidase dimerisation domain   
 195::351  1.2e-12 27.8% 0051390 00513901 1/1   rial exopeptidase dimerisation domain   
 194::353  3.9e-12 33.3% 0053285 00532851 1/1   rial exopeptidase dimerisation domain   
  42::160  1.6e-11 26.8% 0049011 00490111 1/1   pendent exopeptidases                   
 195::353  7.5e-10 23.0% 0043110 00431101 1/1   rial exopeptidase dimerisation domain   
 194::351  4.6e-09 22.8% 0051475 00514751 1/1   rial exopeptidase dimerisation domain   
  60::439  2.8e-08 22.0% 0053258 00532581 1/1   pendent exopeptidases                   
   1::439  1.3e-06 23.9% 0043109 00431091 1/1   pendent exopeptidases                   
   1::441


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLYDETLTLLQELIRNACVNDLTPDSGQEIRNAESLERFFEGTPNVEITKLEPRPGRTSIIVTVPGSDP
00479711   1/1  -lledlleavdalldellellrelvripsvspdpealdlaplgegeaeaadllaelleel.gfevelv..
00502001   1/1  ld.ldrllellkelvripsvsddlvtrpalsggeaeaadylaeeleel.Gleverid...gvgnviatlp
00488991   1/1  --edldellellrelvai...pslsgdp.eeaeaadllaeeleel.glevellevpdgvgnvvatlpgsd
00461341   1/1  -llllekllelidllldellellrelvs...ipsvspgeeglleaadylaeelkel.Glevellevpeld
00501761   1/1  --sedellellrelvripsls......geeaeaadllaeeleel.gleveli.evdgvgnvvatlggggp
00468271   1/1  ---leellelllelvripsvsgngdgrlpstegeaevadyladeleel.glevelvd...glgnliatlp
00517621   1/1  ---alllllllllllllllsladlsklldaidldellellrelvs...ipsvsgs.pgeaaaadyladel
00513891   1/1  -delldeliellrdlhripel......sfeeaetadllaelleel.gfeverve..vgrtnvvatlkggg
00501821   1/1  --dleellellkelveips......psgneeevadllaeeleelglevevdelg......nviarlpGsg
00527871   1/1  --------ellkeLveipsps......gnekevadylkeeleelgl.evevdelg....nviatlkgkdp
00463101   1/1  ---Lhlvdlpkipslpisadrllkllrelaipsliprpsls.pgeraaadlladelkal.Glevvlidvg
00529401   1/1  ---kdldellellrelvrip......svsgeeaeaadylaeelkel.glevevd....gvgnviatlkGs
00492401   1/1  ---lllllllalvaallkaidaerllehlkelts...igprlagspgeeaaadylaeelkel.gleveld
00501841   1/1  ----eellellkeLleips......psgneeevadylaeeleelgf.evevdnlg....nliatlkgkgd
00513431   1/1  -----ellellkelveipspsg......neeevadllaeeleelglevevdnlg......nviatlkgsg
00509511   1/1  ----eellellkelveips......psgeerekaadllaeeleelgl.eveidelg....nviarlkg..
00461351   1/1  ----------------------------------------------------------------------
00511721   1/1  ----------------------------------------------------------------------
00532841   1/1  --keeilelieelleelielrrdlhahPelsf......eefetaallaelLeel.gfe...vergvggtg
00514741   1/1  ------------------------------------------------------------viariegtee
00501771   1/1  ----------------------------------------------------------------------
00513901   1/1  ----------------------------------------------------------------------
00532851   1/1  ----------------------------------------------------------------------
00490111   1/1  -----------------------------------------kiPalpislsdatlllrllkglsfigraa
00431101   1/1  ----------------------------------------------------------------------
00514751   1/1  ----------------------------------------------------------------------
00532581   1/1  -----------------------------------------------------------NviatipGsdp
00431091   1/1  meielllalllrideerllellkelasigspsallelsssdggvtrlalsgeereardylaeeleelGle


                         -         -         *         -         -         -         -:140
query           NAEPLTLLGHTDVVPVDLPKWTKDPFGAEISDGQIWGRGSVDMLFITATQAAVTRQVAREGGLRGTLTFV
00479711   1/1  ..grpnliatlgggd...ptvllygHlDvvpvgd.gwttdPfeltidedgrlyGrGaaDdKgglaaalea
00502001   1/1  gsvgpglptvllgaHlDtvpvg.dgwdldPllvlnlegllilldlegllldigdfvlfeltiddgriygr
00488991   1/1  pglptvllgaHlDvvpvgetgwdtdPflalsieggklygrGaaDdkggvaalleaaralkelgiklkgti
00461341   1/1  gggnviatlpgsgp..ptvllsaHlDvvpvg.dgwtvdpf..tiedgrlyGrGaaDdkggvaallealra
00501761   1/1  ...tvllgaHlDvvpvgeldgwgvdPfeasiedgklygrGaaDdkggvaalleaaralkelglklkgtvv
00468271   1/1  gtgggdlptillaaHlDtvpvggglgvkpfillnydgddivlgledlvldiwatdpfeaviddgriygrG
00517621   1/1  eelldGleveldsftvplpvegvgggnviatlpGspd..ptvllgaHlDvvpvgeedgw...........
00513891   1/1  gg.ptillrahmDvvpvge..wtgdpfastv.dGvlhgrG.hDmk.laallgaaealkelglelkgtvvl
00501821   1/1  pg.pkvllgaHlDtvplg......vpfilvlddgriygrga.Dnkagvaallealralkeag.lpgdiev
00527871   1/1  g.ptvllgaHlDtvg........dpvkliiedgrlygrga.Ddkagvaallealralke...pkrdiyfv
00463101   1/1  levevdgvgnvvarlpGsdpgkptillgaHlDvvpv......................GaaDnksgvaal
00529401   1/1  dpg.ptvllgaHlDvvp..........................D.kggvaalleaaralkelglklkgti
00492401   1/1  efsvltleyvesgnviatipGsdppdevvllgaHlDsvpvg.p...........ddgtiygpGadDdasG
00501841   1/1  ..pkillaAHmDtvgl........pvkpiiedgflygrg.lDnkagvaallealkalkelk.lpgdvylv
00513431   1/1  g..ptvllaaHlDtvgl........pvkpiiedgklygrgalDnkagvaallealralkeag.lpgdvyl
00509511   1/1  gd.pkvllgaHlDtvglgvkpi........iedgdligggalDdkagvaalleaaralke...lkgtlvf
00461351   1/1  ----------------------------------------------------------------------
00511721   1/1  --------AHlDtvg..............ieggfiyggg.lDdkagvaallealralke...pkgdiyfv
00532841   1/1  vvavlggg..pgptialrAdmDalpileetglpyasf....vdgvmhacGhddht...aallgaaralke
00514741   1/1  pdevvllgsHlDsvpvg.....................GalDggsGvaalleaaralkelgikpkrtiev
00501771   1/1  ----------------------------------------------------------------------
00513901   1/1  ----------------------------------------------------------------------
00532851   1/1  ----------------------------------------------------------------------
00490111   1/1  gslgeaaaaeyllarleelglvvllveftvetvtsyNviaripGsd.pdevvllgaHlDsvg........
00431101   1/1  ----------------------------------------------------------------------
00514751   1/1  ----------------------------------------------------------------------
00532581   1/1  pdevvllgaHlDsvg......................pGadDnasGvaalleaaralkellklgwkpkrt
00431091   1/1  vrvdevg......nliarlpgknpg.pavllgaHlDtvp.....................ggGayDgklG


                         +         -         -         -         -         *         -:210
query           GVADEEARGGLGAKWLSEEHQNLFSWKNCLSESGGSHLPVHDGSDAVVINVGEKGAAQRRIHVNGDAGHG
00479711   1/1  lealkeaglklkrtirllftgdEEsgs.lgarallealk............kadaaivleptgl..ivtg
00502001   1/1  GttllAlDdkggvaalleaaralkelgllkgtivflftpdEEv.G.lGaralaeelle.adialvldpdm
00488991   1/1  vflftpdEEvggllGakalvedgl.llgadidavldldmvgepgl....pvgviglrGsltaelt.....
00461341   1/1  lkelglklkgtirflftpdEEv.gllGakalveel..llkvdaalvldptglgp........tivigekg
00501761   1/1  flftpdEEvglllGakalvedll........aellkvdaalnldpgaldllg.palviglrg........
00468271   1/1  atllGaDdkagvaallealralkeqgiphgdiellftpdEEvGl..gakallasll.kvdaaivldpggg
00517621   1/1  ..ygrGaaDdkggvaalleaaralkellkklkdllglkpkrtirflftpdEEvarfgldlsGllGarala
00513891   1/1  lftpdEEggg..Gakaliea..glfdgvdaalvldptpllplg....ivagrkgllla............
00501821   1/1  vftvdEEv.glrGakalaeal.............dpdaaialDptgag.lvpglkgalseliivkGpa..
00527871   1/1  ftvdEEv.GllGakalaesl.............kpdaainlDptgag.ivigvkgllrvtvtvkgka...
00463101   1/1  leaaralsklvkeagikpkrtivflftgdEEg.gliGsralledllkelgkdvdavinldgigl......
00529401   1/1  vflftpdEEv.gllGakalveellellkvdaalnldptgggpl...........................
00492401   1/1  vaalleaaralkelgfkpkrtivfvfftaEEv.GllGskayaenlpellkkvvavlnlDmigs.......
00501841   1/1  ftvdEE.vGllGakalaea....lkpdlaialDvt...................................
00513431   1/1  vftvdEEv.GlrGakalaeal.............dpdlaivlDptga..............vdvpgvgah
00509511   1/1  vftvdEEv.gllGaralagal.............kpdaaialDvtgagd..............vlglkgh
00461351   1/1  -----------------------------------------------------kGllrfevtvtGkaaHa
00511721   1/1  ftvdEEv.GllGakgla....sklkpdfaialDvtgagdppggkgahaglhlgkGpv.............
00532841   1/1  lrdelkgtvvllfqpaEEggg..Gakamiedglldd...vdavlglhptpglpvg...............
00514741   1/1  vawtdEEgarFgvgllGsrayagallleaalavldldg..........................vtgaga
00501771   1/1  ------------------------------------------------------GslrfritvkGkggHa
00513901   1/1  ------------------------------------------------------gslrfeitvtGkggHa
00532851   1/1  -----------------------------------------------------aGslrfeitvtGkggHa
00490111   1/1  ............igpGAdDn--------------------------------------------------
00431101   1/1  ------------------------------------------------------GllrlkvtvtGkgaHA
00514751   1/1  -----------------------------------------------------lgslrfeitvtGkggHa
00532581   1/1  ivfaawtaEE.fGllGStayaenlkeellekvvaylnlDmigsggslllvsasplllslleeaaklvlgp
00431091   1/1  vaallealralkdsgiklkrplevvftvdEEgarFgvgllGsralagk....lkpdillaldslvdadgv


                         -         -         -         +         -         -         -:280
query           SIPFDRDSAIVKIGEVARRIAAADLKVAKDDIWQGFVQAHRFDPETEQALLSGTSPEAYAEFGGLSRFAH
00479711   1/1  lk....................................................................
00502001   1/1  lglvtagkg.............................................................
00488991   1/1  ......................................................................
00461341   1/1  sltfeltv..............................................................
00501761   1/1  ......................................................................
00468271   1/1  gelvvgkgg.............................................................
00517621   1/1  edl..lkpdvaiildehll.....lepivgvinldmkGslgfeitvtgkgg...................
00513891   1/1  ......................................................................
00501821   1/1  ......................................................................
00527871   1/1  ......................................................................
00463101   1/1  gdglfitvgskglleleievagkl----------------------------------------------
00529401   1/1  ......................................................................
00492401   1/1  ......................................................................
00501841   1/1  .....................................................................p
00513431   1/1  sglalgkgpvi...........................................................
00509511   1/1  haephigkgpv...........................................................
00461351   1/1  attPelgvnAilaaallilalqalv......dpl....................................
00511721   1/1  ......................................................................
00532841   1/1  ...eitvkGkggHa........................................................
00514741   1/1  lagigllpellvsairalvaallelhieqgpv......................................
00501771   1/1  ayphlgvnaivaaaelilalqeivsrevndplpp....................................
00513901   1/1  atPhlgvnAilaaaelilalqel.........................................lsrlld
00532851   1/1  atPhlgvnaivaaaelilalqel.........................................vsrlld
00490111   1/1  ----------------------------------------------------------------------
00431101   1/1  GatPmlgrrdAllaaaelilalqtivsr..........................................
00514751   1/1  GatPmhlgvdallaaarlilalqtivrdld........................................
00532581   1/1  ......................................................................
00431091   1/1  slkealv.niglaggilggalvndiaafvelhieqgpvleaeglpigv......................


                         -         *         -         -         -         -         +:350
query           AVSHLTIAQTVVRAGQAINVLPSHAYLELDIRTLPGQTNDYVDDTLRGALGDLADEVEIEHLISEEATVS
00479711   1/1  ......................................................................
00502001   1/1  ......................................................................
00488991   1/1  ......................................................................
00461341   1/1  ......................................................................
00501761   1/1  ......................................................................
00468271   1/1  ......................................................................
00517621   1/1  ......................................................................
00513891   1/1  .....................................................................p
00501821   1/1  ...............................................................lrypdas
00527871   1/1  ..............................................................irypdasl
00463101   1/1  ----------------------------------------------------------------------
00529401   1/1  ..............................................................evllrggp
00492401   1/1  ......................................................................
00501841   1/1  agdpptlnvgviggGpainvipaa..............................................
00513431   1/1  ................................................................rvpans
00509511   1/1  ...............................................................ikvpdas
00461351   1/1  ...dpavltvgiieggnavNviPdeaeltldvRaldgevleellerleeiaegia.atgvevelelllgy
00511721   1/1  ..............................................................ievfdsgv
00532841   1/1  ......................................................................
00514741   1/1  ......leaaglpigvvtggaginrlpvtvt.......................................
00501771   1/1  ....tvltvgvinggtgatNviPgeaellgdiRtlpeetleellerleeivegiaaaygleael------
00513901   1/1  plpptvltvgvieggtavNviPgeaeltldvRtldeetleellerleeilegialaygvevelelllgy.
00532851   1/1  plpptvltvgvieggtavNviPdeaeltldiRtldeetlllerleeivegiaaalgvevelelllgypal
00490111   1/1  ----------------------------------------------------------------------
00431101   1/1  ....pgavltvgiievggnavNviPgeatltldvRsldeevleallerlreileaiaaalgveveielll
00514751   1/1  ....plavltvgvieaggnavNviPgeaeltldvRsldeevlelllerleeiaegiaaalgvevelelll
00532581   1/1  ......................................................................
00431091   1/1  ........................................vtgivgirrlrvdveg..............


                         -         -         -         -         *         -         -:420
query           PTDSRLYNTLEKVLGDFFPDAPVVPIISSGGSDLRFGRRLGGVGYGFAVHARERTLAEAMGQLHSHDEAL
00479711   1/1  ...............lvtdldsplvkalleaikevtgl.epvligvgggtdarffaelgipavlfgpg..
00502001   1/1  ..............................lpapatptdselvdllreaaeel..gippqldpsgggtDa
00488991   1/1  ......splvdalkeaaeel..giepvllpsgggtDaaffaelgipavlfgpggggial......aHspd
00461341   1/1  ...................plvdalaeaaeellgiepv.lvpigggtDaaffaelgipavlllgpgg.dn
00501761   1/1  ....pvtpndselvdllaeaaeelf.giepvllpsgggtDaaffaeagvpavllgpg.........ggla
00468271   1/1  ..............................papalppdsplvdllleaaeel..giepqievigggtDag
00517621   1/1  .....................................................palsdlvkalakallg.
00513891   1/1  vlvndsplvellaeaarelgge.vpelepsggstDfgfflelvgiptvllgp........gdgallHspd
00501821   1/1  lptdsalvdllveaaeel..gippqldvvsgggtDagalalaglgiptvllgpgsrn.........aHsp
00527871   1/1  pldselvdllleaakelgipyqllv.lsgggtDagafakaglgipavligpgsrn.........aHspnE
00463101   1/1  ----------------------------------------------------------------------
00529401   1/1  pvtpldselvdllkeaaeel..giepvllvsggggsDaaffaeaGipalllgpgslgd.......yaHsp
00492401   1/1  ...............ggrgllfrlgpdagspalvdllkeaakel..glplaldvspllgggsDhasfaka
00501841   1/1  ..dselvdlllelakel..gipyqlevvplgggtDagafllaglgiptvllgpgiry.........aHsp
00513431   1/1  lpadpalvdllleaaeelgiplqldvv..sgggtDagaillarlgiptvll.........gpggryaHsp
00509511   1/1  lpadselvdllleaaeel..gipyqllvspgggtDagafalaglgiptvllgvglrn.........sHsp
00461351   1/1  p---------------------------------------------------------------------
00511721   1/1  padselvdllveaakel..gippqldvsrgggtDagaillarlGiptvligvp.............srnm
00532841   1/1  .............lvndpalvellaeaakelggeelvveleplmgseDfgfvl.lgvPgvffglgigtpg
00514741   1/1  ..............laeaaeel..gleprllvsgagsDaaafarlgppamlfgpg........rdgisHs
00501771   1/1  ----------------------------------------------------------------------
00513901   1/1  p---------------------------------------------------------------------
00532851   1/1  v.P-------------------------------------------------------------------
00490111   1/1  ----------------------------------------------------------------------
00431101   1/1  gyp-------------------------------------------------------------------
00514751   1/1  g---------------------------------------------------------------------
00532581   1/1  .................igsslledlldalaallelhieqgpvleaglgggsDhasFlkiaGipalgltf
00431091   1/1  ...................................vkalveaakal..gippqllvsgagtDaaalakgi


                         -         -         +         -         -         -         -:490
query           YLEDLELTVRGYDSVVREFLG-------------------------------------------------
00479711   1/1  .......gdlaHspnEyvsld-------------------------------------------------
00502001   1/1  gffaelGiptvdlgpggld..-------------------------------------------------
00488991   1/1  Ervdlddlekgakllaalllel------------------------------------------------
00461341   1/1  ........aHsepnErvdlddl------------------------------------------------
00501761   1/1  Hspnervdlddlekgaklla--------------------------------------------------
00468271   1/1  flsaagiptvnlgpggrn...-------------------------------------------------
00517621   1/1  .lgippslllelllflnelspl------------------------------------------------
00513891   1/1  eyvdldallkgakvlaallella-----------------------------------------------
00501821   1/1  dEyvslddleaaaklllalll-------------------------------------------------
00527871   1/1  tvdlddlekaaklllalllel-------------------------------------------------
00463101   1/1  ----------------------------------------------------------------------
00529401   1/1  .Eyvdlddlekgakllaallle------------------------------------------------
00492401   1/1  gipaldfgpgadgy....p---------------------------------------------------
00501841   1/1  dEyvslddleaaakllaall--------------------------------------------------
00513431   1/1  dEyvslddleaaaklllalle-------------------------------------------------
00509511   1/1  dEyvsledleaaaklllalle-------------------------------------------------
00461351   1/1  ----------------------------------------------------------------------
00511721   1/1  HspdEyvslddleaaakllla-------------------------------------------------
00532841   1/1  kgl..aplHspdfdvdeeal--------------------------------------------------
00514741   1/1  pdEtvdledlaagakvlalllle-----------------------------------------------
00501771   1/1  ----------------------------------------------------------------------
00513901   1/1  ----------------------------------------------------------------------
00532851   1/1  ----------------------------------------------------------------------
00490111   1/1  ----------------------------------------------------------------------
00431101   1/1  ----------------------------------------------------------------------
00514751   1/1  ----------------------------------------------------------------------
00532581   1/1  ggeanhagttpmplyHtpy---------------------------------------------------
00431091   1/1  ptamifvp........srd---------------------------------------------------