[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55908.1


[Show Plain Result]

## Summary of Sequence Search
   1::165
   2::161  2.3e-38 32.3% 0048525 00485251 1/1   tin-like                                
   3::165  1.1e-36 29.4% 0050162 00501621 1/1   tin-like                                
   2::157  1.4e-35 35.1% 0046379 00463791 1/1   tin-like                                
  15::156  1.5e-34 37.3% 0039557 00395571 1/1   tin-like                                
  16::156  6.1e-34 35.0% 0039558 00395581 1/1   tin-like                                
  15::162  8.4e-33 32.4% 0048950 00489501 1/1   tin-like                                
   9::161  8.6e-33 32.7% 0052707 00527071 1/1   tin-like                                
   4::158  1.1e-32 32.3% 0048201 00482011 1/1   tin-like                                
   9::157  3.8e-32 31.8% 0048264 00482641 1/1   tin-like                                
  14::162  1.4e-30 30.9% 0049951 00499511 1/1   tin-like                                
  12::157  1.3e-29 31.7% 0047593 00475931 1/1   tin-like                                
  11::156  6.8e-22 23.4% 0035460 00354601 1/1   tin-like                                
   8::160    9e-22 28.0% 0048355 00483551 1/1   tin-like                                
  11::156  5.6e-12 22.6% 0052712 00527121 1/1   tin-like                                
   5::158  7.2e-10 25.8% 0051644 00516441 1/1   tin-like                                
  11::156  5.5e-09 18.2% 0047582 00475821 1/1   tin-like                                
  21::156  2.1e-05 25.4% 0051629 00516291 1/1   tin-like                                
  10::156  8.4e-05 19.4% 0044868 00448681 1/1   tin-like                                
   7::160  0.00013 16.9% 0043194 00431941 1/1   tin-like                                
   1::165


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANYTVPGINENDAKQLIDGLQERLTDYNDLHLILKHVHWNVTGPNFIAVHEMLDPQVDLVRGYADEVAE
00485251   1/1  -lkllltvigldmkarekvielLnklladeltlylqykqhhwnvkgpgfiglhelfdelaeeelehadel
00501621   1/1  --gltliglsmkarekvielLnklladeltlylqykqhhwnvkgpgfiglhelfeelaeeelehadelae
00463791   1/1  -tevsnllvtlsgldveareklielLnklladlialylkykqahwnvkGpgfrslhelldeladelreha
00395571   1/1  --------------ekvieaLnelladllvlylkykqyhwnvkgpnffglhelldelyeeerehadelaE
00395581   1/1  ---------------kvielLnklladelvlylqykqhhwnvkgpgflalhelldelaeeerehadelae
00489501   1/1  --------------lkvieaLnklladeltlylqykqhhwnvkgpgfiglhelfdeqaeeelehadelae
00527071   1/1  --------ldekdrekvielLnklladeltlylqyklhhwnvkgpgflslhelfeeqaeeelehadelae
00482011   1/1  ---sllallrlalgelvtvnglsmkgdkvekvieaLnelladeltaylqylqhhwnvkgpgfiglhelfe
00482641   1/1  --------mkgdarekvieaLnklladeltlylqyklhhwnvkgpgfielhelfeelaeeelehadelae
00499511   1/1  -------------mekvieaLnklladeltlylqylqhhwnvkgpgfiglhelfeeqaeeelehadelae
00475931   1/1  -----------kldekvieaLnklladeltlylqyklhhwnvkgpgflslhelfeeqaeeelehadelae
00354601   1/1  ----------mkgdekvielLnkalagelvainqyllhawnakgegfeglaelfeeiaieelehadklae
00483551   1/1  -------gmkgld.ekvielLnealagElaaslqylamawnakgpgfpglaelfeeqaeeerehadklae
00527121   1/1  ----------mkldekvielLnkalageltainqYllhawyvkdvglpglaelfeeqaeeerehadklae
00516441   1/1  ----eieekyeaelkksdidhhvPtagamlnhllAnllvlyvklhqahwyvkGpnfftl...feelynel
00475821   1/1  ----------mkgdekvielLnkalagEltainqYlaharyakdwglpglaklfeeqaieEleHadklae
00516291   1/1  --------------------lnhilanllilivklhqlhwyvkGpnfltlh...eelynevdeqfdelae
00448681   1/1  ---------rqnlsekveeaLnkalageltasyqYlamaayadgvglpglaklfreqaeeelehadklae
00431941   1/1  ------sgirqnlsekveeaLneqlnleltasyqYlsmaayfdrddvglpglakffreqaeeerehaekl


                         -         -         *         -         -         -         -:140
query           RISTLGGAPVGTPEGHVADRTPLQYERNAGNAQAHLTDLNRVYTQVLTGVRESMASAGPVDPVTEDIYIG
00485251   1/1  aerilalgglPlgslselaelssikevpagvldveemlealleaeeaviellreaielaeeagDpvtadl
00501621   1/1  rilalgglPvgtlselaelssigevpagvldveemlealleaeeaaiellreaielaeeaDyvtadllee
00463791   1/1  DaiAERiralggtalgsleevaklstlpelpaglvdvkdvlkllleaeeavietlreaideag..DptTa
00395571   1/1  rilalggtPlgtlkevaelssikelpggvlsaeemlkalledeetvikllrelielaeeagDpvtadlle
00395581   1/1  RilalgglPvgtlaefaelsslkelp.ggldveemlealleaeeaaiellreaielaeeagDyvtadlle
00489501   1/1  rilalgglPlgtlselaelssigelpagvvldveemlealledeeaviellreaielaeeegDyvtadll
00527071   1/1  rilalggtPlgtlselaelssigevpagvvdvkemleelleaeeaaiellrelielaeeagDpvtadlle
00482011   1/1  eqaeeerehadklaerilalGglPvltlsevaelssikeppagftsveemleallelekaviellrelie
00482641   1/1  rilalggtPlgtlqellklssigevp.gvldvkemlealleaeeaviellreaielaeeagDpvtadlle
00499511   1/1  rilalgglPlgtlselaelsslkelpigflldveemleallelekaviellrelielaeeegDyvtadll
00475931   1/1  rilalggtPlgtlsellelsileevp.gvldvkemleelleaeeaaiellreaielaeeagDpvtadlle
00354601   1/1  rilalggtpvlslielpe.........igedvlemLeaalelekevielyrelielaeeegDyvtadlle
00483551   1/1  rilalGgrp.........vlspikepagwgdvlealeaalelEkevtesyrelielaeeegDpatadlle
00527121   1/1  rilflgglpvlqaiekle.........igedvlemleaalelEkeaielyrelialaeeegDyvtadlle
00516441   1/1  delfdeiaerLlalgekplstleefleeystleedgakkyltaeemleelvndfdtlllflqkaIeladk
00475821   1/1  rllelggrptl.........qalekpeigedvleaLelalelEkeaielyrelaelaeeegdyvtrdlle
00516291   1/1  lLlaeGelpptttaefleyatvleedgaakyltaeelleslvnDfdtirlfilraiklaekegdfeladl
00448681   1/1  rilelgglpv......lqaiekpeidwgstlealeaalelEkevtesllelielAeeeg..Dyatadfle
00431941   1/1  aeyllelgglvvlqd....iskpeidewgsllealeaalelEkevtesllelaalaeeeg..Dpatadfl


                         +         -         -         -         -         *         -:210
query           QAAELEKFQWFIRAHIVDVDGNIQE---------------------------------------------
00485251   1/1  leeilaeeekhawmLeallgk-------------------------------------------------
00501621   1/1  ilaeeekhawmleallgkieldllq---------------------------------------------
00463791   1/1  dlleeiiaelekhawfl-----------------------------------------------------
00395571   1/1  eilaelekhiwmleal------------------------------------------------------
00395581   1/1  eilaeeekhiwmleal------------------------------------------------------
00489501   1/1  eeilaeeekhawmleallgkie------------------------------------------------
00527071   1/1  eilaeeekhawmLeallg...-------------------------------------------------
00482011   1/1  laeeagDpvtadlleeil----------------------------------------------------
00482641   1/1  eilaeeekhawmleall-----------------------------------------------------
00499511   1/1  eeilaeeekhawmleallgkie------------------------------------------------
00475931   1/1  eilaeeekhawmLeall-----------------------------------------------------
00354601   1/1  eileeeeehewmleal------------------------------------------------------
00483551   1/1  eileeeeehawmleallekl--------------------------------------------------
00527121   1/1  eileeeeehadwleal------------------------------------------------------
00516441   1/1  esdfaledlligllgsle----------------------------------------------------
00475821   1/1  eilkeeeehadlleal------------------------------------------------------
00516291   1/1  lidllgyidkqiwllq------------------------------------------------------
00448681   1/1  efleeeeehiklledl------------------------------------------------------
00431941   1/1  esefleeqvehiklledlld--------------------------------------------------