[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00332


[Show Plain Result]

## Summary of Sequence Search
   1::587
  50::539  PF00083 0.0% 23.2718894009217  Sugar (and other) transporter 
  98::484  PF07690 0.0% 21.8241042345277  Major Facilitator Superfamily 
   1::587


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATLTAGGNSAFKNFHNQFAHIQDPNERRRLALAEIDKAPFGWYHIRAIVVAGIGFFTDAYDIFAINLAS
PF00083         -------------------------------------------------lvaalggflfGYdtgvigatl
PF07690         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AMLGVVFWLDAKDKPGKIPSSADTAIKVATSGGTVIGQVGFGWLADVVGRKKMYGLELMVIIFATLAQAL
PF00083         tlikfaknfglltsksakeessvlsglivssflvgaliGslfaglladrfGRkksllvalvlfvigavlq
PF07690         ---------------------------tlyslgyaiasllaGrlsdrfGrrrvlllglllfalglllll.


                         +         -         -         -         -         *         -:210
query           SSDSPGVSIVGLLIFWRVIMGIGIGGDYPLSSIITSEFATTKWRGAMMGAVFAMQGIGQFAAALVALIVA
PF00083         aaakak...ksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgslyqlaitvGilvaaiiglg
PF07690         fa.....sslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGailgpllggll


                         -         -         -         +         -         -         -:280
query           AGFKESLKTAESESQCSGVCQVAVDKMWRVVIGFGAVPGCIALYYRLTIPETPRYTFDVQRDVVKGAEDT
PF00083         l.nktsn...................adgwrillglqlvpallllllllflpeSpryl..vlkgkleeAr
PF07690         asslg.......................WravFlilailsllaavlvllllprepperkrkspaeel...


                         -         *         -         -         -         -         +:350
query           KAYMLGKPEGSPDELQRIATLEQSQSQLQVPKASWSDFWTHYKQWKHGKVLLGTAGSWFFLDVAFYGLGL
PF00083         evlkklrgsedadqeiqeekdslersreee....aswkelfsqkt..vrqrlligvvlqifqqltGinai
PF07690         ................................rkepaplvp...awklllkppvlwllialllfffvfsg


                         -         -         -         -         *         -         -:420
query           NNSIILSAIGYTGGKDMYEIMYNTAVGNLILICAGAIPGYWVTVATVDTLGRKPIQIMGFTMLTVLFIVI
PF00083         myYsptifetlglsks..........llvtiivgvvnfvftlvai.......flvdrfGRRtllllGlag
PF07690         lltllpl...ylqevlglsp.......glllaglllgllaligaigalllgrlsdrlgr..rrrlllall


                         -         -         +         -         -         -         -:490
query           GFAYDKLLHSNNGLLALYVIAQFFFNFGPNSTTFIVPGECFPTRYRSTSHGLSAASGKVGAIIAQCVFGP
PF00083         maicavflgivvlllvakskaasivaivfillfiaffalgwgpvpwvlvsElfpqsvRpkalaiavaanw
PF07690         llllaalglallaftssavwllvvlvliGf.glglvfptllalasdlappeerGtasglfntag------


                         *         -         -         -         -         +         -:560
query           LVSRGAKPGSSEKPWLKHVMQIFALFMLCGLITSFLIPETKRKTLEELAGEVPETPNYDPVTAGHARREG
PF00083         lanfligllfpiiteaig......ggyvflvfagllvlf..ilfvfffv---------------------
PF07690         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           QQVKGGEETPETVSPDMQPNEKHTTIV-------------------------------------------
PF00083         ----------------------------------------------------------------------
PF07690         ----------------------------------------------------------------------