[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00337


[Show Plain Result]

## Summary of Sequence Search
   1::462
  87::423  PF03630 0.0% 60.1941747572816 PF03630 Fumble 
   1::462


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSSQRSAADLDTSRTKPHRPFQEDHAAVQRLEEAISHPGSVKINVKGAFIVDEQPTEQSRVVFDCRDGI
PF03630         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HYEHKDIRLPHHTDVVSHVAVDIGGSLAKLVYFSPELGSSADGGRLNFLNFETERIDLCIDFLKQLKENH
PF03630         ----------------sklalDiggtliKlvyfsakdesaeeeskekeslkelllkekegrlhfikfetk


                         +         -         -         -         -         *         -:210
query           RKLNGSAPGPLCIMATGGGAYKYYDRLKEELGVDIIREDEMECLIIGLDFFITEIPNEVFTYSETSPMEF
PF03630         kidkvleflkekikeh...knlkkektvlvaTgggafkfedllkeklnvklekedeleclikGlnfllke


                         -         -         -         +         -         -         -:280
query           AEARPDVYPYLLVNIGSGVSMVKVSAPRRFERVGGTSLGGGTFWGLMSLLTGARTFDEMLAMAELGDNSG
PF03630         ikaEvftyekdeegeklekkqlnskdlypyllvNigsGvSilkvegedqfkrvgGsslGGGtflGLlsLl


                         -         *         -         -         -         -         +:350
query           VDMLVGDIYGTDYTKIGLKSSTIASTFGKVFKMQRLAERSAQGSECLCESDSESERDVSQFRREDISRSL
PF03630         tgaksfdellelaqkGdnsevDmlvrdiYggdyeklglkgsliAssfgkvl.....eeeke.........


                         -         -         -         -         *         -         -:420
query           LFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAF
PF03630         ...........eefkkediaksllvaisnnigqiayllaekekvkriyfgGsfirgnaltmktlsyainf


                         -         -         +         -         -         -         -:490
query           LKRQPQDWGRRRSIENTAATRFAAYREELRSATKNGTELPPT----------------------------
PF03630         wsk-------------------------------------------------------------------