[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00341


[Show Plain Result]

## Summary of Sequence Search
   1::460
 129::178  PF06432 0.0% 85.7142857142857  Phosphatidylinositol N-acetylglucosaminyltransferas 
 256::449  PF06432 0.0% 64.5348837209302  Phosphatidylinositol N-acetylglucosaminyltransferas 
   1::460


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASSPPPPNTTSRPQSLGTPAAPVPPPVPVETHPNRAGLKPRPPLRPPPDPSRLAPEDAYFAHSPPRLRP
PF06432         ----------------------------------------------------------------------
PF06432         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LNLPNNHAASNPDLLNRVVATPAAVAALRPPPAVPGTKPKATGEARRDRGRSRRRKRQWKKLLWVKQSYP
PF06432         ----------------------------------------------------------wkKlLwvkqsyp
PF06432         ----------------------------------------------------------wkKlLwvkqsyp


                         +         -         -         -         -         *         -:210
query           DNYTDTETFLDHLQRNPRLRPYDFWPLVADFTVIVQHSSVGGQLGDPMYDILLVSLGLLGGKGSDGIRAI
PF06432         DNYtD.etFleelqrnprvrkydfwklvadstvivqhv--------------------------------
PF06432         DNYtD.etFleelqrnprvrkydfwklvadstvivqhv--------------------------------


                         -         -         -         +         -         -         -:280
query           AAWYGSAIQQTTAQAPALCPVPQETTDKKSLRTWAWAISRFIQYRSLPRRQTKSALLIFCALQGLSPILK
PF06432         ---------------------------------------------skrlstvksallivfvlllLSPilk
PF06432         ---------------------------------------------skrlstvksallivfvlllLSPilk


                         -         *         -         -         -         -         +:350
query           SLTKSTTSDSIWAMSCWLMIINVFFFDYGSGTKENQNLSNNAGAGAVAAKFPASLSTNAALMASTVLASR
PF06432         sLTkstssDsIwalsfwllllnlfffdys......tetattek...........kklsaslStnaalmas
PF06432         sLTkstssDsIwalsfwllllnlfffdys......tetattek...........kklsaslStnaalmas


                         -         -         -         -         *         -         -:420
query           LKSTTHVFSLTLFSIEVFGLFPVFRRHLRAISWRGHVLLTVSLVIAAGAAVGVTLKGGYKGMILGILIGA
PF06432         tvLASRLpsttqvFslllfsievfalfPvfrrslrktskrlhvvltvllvilavaavg...klllkkill
PF06432         tvLASRLpsttqvFslllfsievfalfPvfrrslrktskrlhvvltvllvilavaavg...klllkkill


                         -         -         +         -         -         -         -:490
query           PSTALAMGGCSWWLIRLQKYKNVVAGPWDQAKPILRRHWD------------------------------
PF06432         llllll..vvlislvaplwlislqkykne-----------------------------------------
PF06432         llllll..vvlislvaplwlislqkykne-----------------------------------------