[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00357


[Show Plain Result]

## Summary of Sequence Search
   1::755
 173::694  PF07690 0.0% 22.7963525835866  Major Facilitator Superfamily 
 167::342  PF00083 0.0% 20.5714285714286  Sugar (and other) transporter 
 565::604  PF00083 0.0% 27.5  Sugar (and other) transporter 
 199::341  PF06609 0.0% 23.4042553191489  Fungal trichothecene efflux pump (TRI12) 
   1::755


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAQDIPSDTIEISHSRSNENTASNDGETSEHRESSAPRKVTWKKFLGVEKDGPDLEAVLDDDNNYGPRDR
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           WTMGILSDKQTEEVPGTILLLTSSRNEPLGLRQQPARVSASSLPSPYPPSRSSSRNPAPQQKRTPDGKIV
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LDPQPEESLNDPLNWPQWRRDLALLSLGFYCMIGGGMTPILAAAFNDVSEEYNVSFQKVALTTGLYMLGL
PF07690         --------------------------------aalarsilgpalplalaedlgispseigwlltlyslgy
PF00083         --------------------------fGYdtgvigatltlikfaknfglltsksakeessvlsglivssf
PF00083         --------------------------fGYdtgvigatltlikfaknfglltsksakeessvlsglivssf
PF06609         ----------------------------------------------------------sslfstlwttgq


                         -         -         -         +         -         -         -:280
query           GIGSVVMSPTAILFGKRPVYIAGATMFIISAVWCALSPTYVSLVIARIFQGIAVSPVECLPSATIAEIFF
PF07690         aiasllaGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwf
PF00083         lvgaliGslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPm
PF00083         lvgaliGslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPm
PF06609         avsilvmgrltdrfgrrpfvilthilglvgaivgctatkfntllaamtllgvaagpagaspl.fvgelms


                         -         *         -         -         -         -         +:350
query           LHERAYRVGIYTLLLLGGKNLIPLVSAAITEGLGWRWIFWVVAITIAFGLVLVFFFVPETFWDRTPRPRT
PF07690         pkeergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllll....prepperk
PF00083         yisEiApkklrgalgslyqlaitvGilvaaiiglglnktsnadgwrillglqlvpallllll--------
PF00083         yisEiApkklrgalgslyqlaitvGilvaaiiglglnktsnadgwrillglqlvpallllll--------
PF06609         nktkflgllivsipvvvtsglspylgqrlaiqgswrwifyiyiitsaiavllivvwyypp.---------


                         -         -         -         -         *         -         -:420
query           KRPKARRSVSDIVAHSFRGRSPEPVTPTEIRQKARDASTQKKQKDLRVDFADDVKSDMRRSGEHPRDSDN
PF07690         rkspaeel..............................................................
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           QVLDEKHVEGEPAGDTVAEGYFSVPPASALTPPSTEEDSTTRKDVLDLESARSQPVSRDISVDASADPLH
PF07690         ......................................................................
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ASLQQIYTSNLRSKPPVSFSQSLKPWNGRIARDNWFRVMTRPFILFAYPAVLWSSMVYALSVGWLIVLSE
PF07690         ..................................rkepaplvp....awklllkppvlw..llialllff
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           AVAEIYRNKESYNFSALATGLVYISPFVGGILGTVVAGKVSDIIVRWMARRNGGIYEPEFRLVMSAPIAI
PF07690         fvfsg.lltllplylqevlglspglllaglllgllaligaigalllgrlsdr............lgrrrr
PF00083         ----lltsksakeessvlsglivssflvgaliGslfaglladrf--------------------------
PF00083         ----lltsksakeessvlsglivssflvgaliGslfaglladrf--------------------------
PF06609         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           CTAMGLMGFGWSAQEKEKWIVPTVFFGILSFGCTLGSTTSITFCVDSYRQYAGEALVTLNFSKNVLHGFV
PF07690         lllallllllaalglallaft.ssavwllvvlvliGf.glglv..fptllalasdlappeerGt------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           FSLFFVDWLHSDGAKTVFVALGGIHLACMLFSIPMYIYGKRARMWTVRKRLMEKF---------------
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------