[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00379


[Show Plain Result]

## Summary of Sequence Search
   1::390
  51::167  PF00153 0.0% 41.9354838709677  Mitochondrial carrier protein 
 176::271  PF00153 0.0% 36.6666666666667  Mitochondrial carrier protein 
 291::386  PF00153 0.0% 42.2222222222222  Mitochondrial carrier protein 
   1::390


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSFPAPSPDLSRGASRLKDGSEPRQSVMIQSGETDDVEVAPALETKSKPAVKPWAHFFAGAVGGMTAATL
PF00153         --------------------------------------------------lsvlksllaGaiAgaiaalv
PF00153         --------------------------------------------------lsvlksllaGaiAgaiaalv
PF00153         --------------------------------------------------lsvlksllaGaiAgaiaalv


                         -         -         *         -         -         -         -:140
query           TSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQSHSILSLSRSAMVHFSETVQILRSIHVHEGWRALFKGLG
PF00153         ttPldvvKtrlq........................ksaasasskykgildalkkiykeeGlrglyrGll
PF00153         ttPldvvKtrlq........................ksaasasskykgildalkkiykeeGlrglyrGll
PF00153         ttPldvvKtrlq........................ksaasasskykgildalkkiykeeGlrglyrGll


                         +         -         -         -         -         *         -:210
query           PNLTGVVPARAINFYVYGNGKRILNDYFGYIPTETPASIHLAAAAVAGIATGTATNPIWLVKTRLQLDKS
PF00153         pnllrvvpaaaikfvtyetlkkllskk--------svlksllaGaiAgaiaalvttPldvvKtrlq....
PF00153         pnllrvvpaaaikfvtyetlkkllskk--------svlksllaGaiAgaiaalvttPldvvKtrlq....
PF00153         pnllrvvpaaaikfvtyetlkkllskk--------svlksllaGaiAgaiaalvttPldvvKtrlq....


                         -         -         -         +         -         -         -:280
query           NASNIPGRGRQYKNSLDCIRQTVRHEGIRGLYRGLTASYLGVTESSLQWVMYEEMKRILARRAARRAADP
PF00153         ..ksaasasskykgildalkkiykeeGlrglyrGllpnllrvvpaaaikfvtyetlkklls---------
PF00153         ..ksaasasskykgildalkkiykeeGlrglyrGllpnllrvvpaaaikfvtyetlkklls---------
PF00153         ..ksaasasskykgildalkkiykeeGlrglyrGllpnllrvvpaaaikfvtyetlkklls---------


                         -         *         -         -         -         -         +:350
query           AHVRGWTDTAEHWVGTITAAGSAKLLAAAATYPHEVVRTRLRQAPTIPAGGGKVQMKYTGLMQCFRVIWK
PF00153         ----------lsvlksllaGaiAgaiaalvttPldvvKtrlq......ksaasasskykgildalkkiyk
PF00153         ----------lsvlksllaGaiAgaiaalvttPldvvKtrlq......ksaasasskykgildalkkiyk
PF00153         ----------lsvlksllaGaiAgaiaalvttPldvvKtrlq......ksaasasskykgildalkkiyk


                         -         -         -         -         *         -         -:420
query           EEGMAGLYGGLTPHLLRVVPSAAIMFGMYEMILRLCGTTS------------------------------
PF00153         eeGlrglyrGllpnllrvvpaaaikfvtyetlkkll----------------------------------
PF00153         eeGlrglyrGllpnllrvvpaaaikfvtyetlkkll----------------------------------
PF00153         eeGlrglyrGllpnllrvvpaaaikfvtyetlkkll----------------------------------