[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00384


[Show Plain Result]

## Summary of Sequence Search
   1::406
 111::171  PF00076 0.0% 29.8245614035088  RNA recognition motif. (a.k.a. RRM, RBD, or RNP dom 
   1::406


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATEDDNFDIDIYGDAGGYNGNENEGDYKVEEPELILDAPETSHQNGIGDGGASGGNNNATENGNHKIFK
PF00076         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TEESGQPGKSASDNLQVPQQGVKRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKD
PF00076         ----------------------------------------lfVgnLppdvteeeLkelFsk...fGpies


                         +         -         -         -         -         *         -:210
query           VTFSEHKVNGKSKGQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGK
PF00076         iklvrd.etgrskgfafVeFeseedaekAle---------------------------------------


                         -         -         -         +         -         -         -:280
query           DDRSRSSSAGFNSPVQGMNFGMGNTGGYRGGRGGGFNRGGMNMGGFNANRNFSNPMGSGGFQGGAMGGAG
PF00076         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FQGTPVGGMQPYGGFGNRGGMMGSNMRGGPNMRGRGGMGGPMGGNMMPVGGMGGVGMGGMGMGGMGGMGG
PF00076         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           MPNQMGGMMGGMQGGMGMQGQGFQGQNPHFNPAFFGQHGGSDGAWNPHGAKRTRQE--------------
PF00076         ----------------------------------------------------------------------