[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00411


[Show Plain Result]

## Summary of Sequence Search
   1::1056
 745::774  PF01608 0.0% 23.3333333333333  I/LWEQ domain 
 862::1054 PF01608 0.0% 60.2094240837696  I/LWEQ domain 
  20::281  PF07651 0.0% 37.2093023255814  ANTH domain 
   1::1056


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSMAYNSTVTRNIDMSRTEADLAVNIRKATSIEETAPKRKHVRSCIVYTWDHKSSASFWAGMKVQPVLAD
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         -------------------sdlevavvKAtshdevPvkekhvreilvltssrekvaalvwalsrrlpltr


                         -         -         *         -         -         -         -:140
query           EVQTFKALITVHKVLQEGHPITVKEAQSHVPWLDSLVRGVAGEGLRGYGPLIREYVFYLESKLAFHRQHP
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         nwvvalKaLilvHklLreGhpsveqellrarkrlsellrlssfddsssktwdysafiraYakyLderlef


                         +         -         -         -         -         *         -:210
query           EFNGLFEYEEYISLKSINDPNEGYETITDLMALQDQIDAFQKLIFSHFRGGANNECRISALVPLVQESYG
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         yrklkvdkgelereeegslvavedpner...tlsmeklldkieklqklldrllkckptgnaltneviiaa


                         -         -         -         +         -         -         -:280
query           IYKFITSMLRAMHTTTGDEEALEPLRGRYDAQHYRLVRFYYECSNLRYLTSLITVPKLPQQPPNLLAEDE
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         lellvkeslklYkaineglinLlekffelskheadkaldiykrfskqfeelkeFyevcknlgvlrsle.i


                         -         *         -         -         -         -         +:350
query           DRPALPKRPSKEVEKEPTPPPKSTIPDPEPINDFWSTEAKRQQEEYEAEQRRLQQQWEDQQRQQMLAQQQ
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         P---------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AQRDFEEQQRLQAEQQRLAQEQLLRDQYQQQTQGRLAELEQENLNARAQYERDQLLLQQYDKRVKDLEEQ
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LNQLNSNYNLQNTSKDDQIRALQEQVNTWRSKYEALAKLYSQLRQEHLDLLQTTKSLKLKAASAQEAIDK
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RERLEREMKTKNLELADMIRERDRALHEKDRISGGNKEELEKVKRELRLAIERAENAERAKSSEISAMLS
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KYNREMADLEEALRNKNRALEEARNSTGERDHDHELTLREKDEEIEVYKSGMEQALMELEELKLNQGDVD
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           KALDTQIDDVLLSSVTKINDIIDSVLQSGVQRVDDALYELDSTMQAGNQNASPPYVLSQIEKASASATEF
PF01608         ----------------------------------------------------------------------
PF01608         ----------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           STAFNNFIADGPNSAHSEIIRTVSVFSGSIADVLSNTKGLTRFATDDKKADQLINAARQSAQSTMTFFRA
PF01608         --------------------------------------------knsrWteGLISAakaVaaatnvLvea
PF01608         --------------------------------------------knsrWteGLISAakaVaaatnvLvea
PF07651         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LQSFRLQDLEPLQKTDVVINNNHEVALNLQKLSKLVDAFAPKSTKLNGTGDLGDLVDRELSNAANAIEAA
PF01608         Adkv------------------------------------------------------------------
PF01608         Adkv------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           AARLAKLKKKPRDGYSTYELRIHDSILEASIAVTTAIAELIKAATASQQEIVREGRGSSSRTAFYKKNNR
PF01608         ---------------------vdeaileaakaitkAvaaLvkaateaQreivekgkgsasrkefykknsr
PF01608         ---------------------vdeaileaakaitkAvaaLvkaateaQreivekgkgsasrkefykknsr
PF07651         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           WTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASNDVAASTAQLVAASRVKATFMSKTQDRLET
PF01608         WteGLISAakaVaaatnvLveaAdkvvkgkaseeeLivaskevaasTaqLvaAsrvkadlnskaqekLee
PF01608         WteGLISAakaVaaatnvLveaAdkvvkgkaseeeLivaskevaasTaqLvaAsrvkadlnskaqekLee
PF07651         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           ASKAVGAACRALVRQVQAIIAEKNRDETEAVDYSKLSGHEFKVREMEQQVEILQLENKLSQARQRLGEMR
PF01608         askaVteatkalvaavksllekeee..keevdlskltlvelktkemeqqveiLklekeLeearkkLgeir
PF01608         askaVteatkalvaavksllekeee..keevdlskltlvelktkemeqqveiLklekeLeearkkLgeir
PF07651         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           KISYLE----------------------------------------------------------------
PF01608         kkeY------------------------------------------------------------------
PF01608         kkeY------------------------------------------------------------------
PF07651         ----------------------------------------------------------------------