[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00429


[Show Plain Result]

## Summary of Sequence Search
   1::476
 387::443  PF00125 0.0% 31.5789473684211  Core histone H2A/H2B/H3/H4 
   1::476


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSPSGPDALRITPRRRRGSAGAGPSPAHNTPSSILQQLAGMAGDPATPAGRSRRSLSASRVSLRRSSRG
PF00125         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VSGIGISDAFAGGSHAPATPHALKAFQRRAAVYTPGRDRRKSGRVQRETPLDILRNLGKALAPTSEVIKS
PF00125         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SPMTETDQETDQQESEDLDEEPDLPRPRLSLPMHEMIVPGDGDGSPEIVPPRLSLPLDEDDFTQRSIEMP
PF00125         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RRERSTRDLATLSRYSLASTRFSEHFGDASRLEYTEEGMEFTAPQGDDNFVDDQIELTAEQPIFDLGGET
PF00125         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EDLRRFDLNFSFPTPDAPQHIENEHEDFVLDTTMPIADDVPVSSDDDFGAGDLELAVREGSPRPPLQESS
PF00125         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PQPPQESRLDQNKERVSKHGIPVPKLPRGIVKRLATRFARTGNGSRTRISKEALAALEKATDWFFEQAND
PF00125         ------------------------------------relkegfyaelrisaealvalqealedlleeile


                         -         -         +         -         -         -         -:490
query           DLSAYSKHSNRKTVDETDVIALMKRQRQIGKGTSVFALAQKYLPKELLQDIRLAKK--------------
PF00125         dAgllaehakrktitprdiqlAv-----------------------------------------------