[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00708


[Show Plain Result]

## Summary of Sequence Search
   1::693
  92::122  PF00172 0.0% 38.7096774193548  Fungal Zn(2)-Cys(6) binuclear cluster domain 
   1::693


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSTVGGHLLPQNDFDIPLNLAASPSVSAIPDYSGNGGAYQIAAKLDSNPSQNATVKQQSAVGSTVAGAA
PF00172         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AAGRGAGPATRPDAPKSKRVRTGCLTCRERHLKCDETLPRCQNCQKSDRLCKRGVRLNFIDTQVAAPPYA
PF00172         ---------------------haCdnCrkkKvKCdakkPaCsnCkklnleCt------------------


                         +         -         -         -         -         *         -:210
query           VPSSHDWQVNFHDESREIASEYLGGYERYPSLKKETPSRRAGPVYAYRETQAMATPHPGPTSASLLTPFA
PF00172         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EHPQPDITAEPIFHGTPQAPAPDSAYTEHAMARSPFDAPKHPLAPANELRPYLNTAEEVLLMQVYVEEVG
PF00172         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LWMDSMDPGKHVFNPSFGEEKALYYYNISTRDLLTCLQDPNRDTVLCATTAVVLNVYEVMCEKAMQRMNH
PF00172         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IAGARALIKECRWNAKTTGIGGACFWLNVGMELLSCLHFNWKMAWDPDTWDIDMNMSLNQGSIAGDEEFW
PF00172         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           THRMLYICAKIANYRATMAYQGLDRSSHDPRLNQRCEEWNALRAWCDEWARCAPRSMMPLGYLHPWETNS
PF00172         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           KSSFPEVWLIKRSAVVGRLFYHTACCLLAKVHPTESEYSDEMLSMQHSHAHDICGIVAHVKDRGVASVSI
PF00172         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           RCLAIAAECVVGREAQEEVIAILDKIIKETGWQVGFLQHELIEKWGWNSATSHMSPHQSQHPQMAAAGPS
PF00172         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           TDLGSSLLNSALPSAPPSRPRMPQGIVNPLMATADFSFDNHPYQNHYVAPHNNHLNNYHYGSY-------
PF00172         ----------------------------------------------------------------------