[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00735


[Show Plain Result]

## Summary of Sequence Search
   1::505
 403::439  PF00018 0.0% 32.4324324324324  SH3 domain 
   1::505


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAGYGTIQGKFLRPFLELVSSVKDFDKELQNYVHHDYVKRKYQDLLGCSNVKLTNTSSLYARYTTSVICN
PF00018         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GIVQSSREICNVSPDDSRPLCADTCALSATSEELVAVNPDLCGTPKSNFMDQIRSDFTICANPADSLTGK
PF00018         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           CISGSENEPAECGYGPNLLGLCGFCAESSPNATDSCCVAADATNRCRGLELPTVPSLPPLFPSSTSSSNP
PF00018         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SASAGAGTGLSGGTIAGIVVGSVAGIALLGALAVFLFIFLRRRRDRNSSIFNQPSPPRKGTSSMQYAPGN
PF00018         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MAQGHGFDVLPGGRVARMSALQNNDDSPRGTAAMKYDSSDSEAFASPASGTRRRPPVTGRRNGSLSSASA
PF00018         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LAGDGDTTSPKSGSGAQFSSPEGVASGQSEQLPYFRDYYSQDDIHPNDKVAVLWAYQPRAADEFELERGD
PF00018         ----------------------------------------------------lYDYearesdELsfkkGD


                         -         -         +         -         -         -         -:490
query           MLKVVGIWDDGWATGIRLNETVEDYDGKHKAQRDSGVSNGTDRRGSSPAPTGEIKAFPLVCVCLPEHWRK
PF00018         viivleksedgWwkgrlkg---------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TIEGDPQTRSSMDSQ-------------------------------------------------------
PF00018         ----------------------------------------------------------------------