[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00742


[Show Plain Result]

## Summary of Sequence Search
   1::241
   5::23   PF10590 0.0% 50  Pyridoxine 5'-phosphate oxidase C-terminal dimerisa 
 188::241  PF10590 0.0% 67.5  Pyridoxine 5'-phosphate oxidase C-terminal dimerisa 
   2::32   PF01243 0.0% 41.9354838709677  Pyridoxamine 5'-phosphate oxidase 
  70::102  PF01243 0.0% 48.4848484848485  Pyridoxamine 5'-phosphate oxidase 
 210::227  PF01243 0.0% 33.3333333333333  Pyridoxamine 5'-phosphate oxidase 
   1::241


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPSGRVSARIVYLKELDERGWVVYSNWGSRAGKGGQVFGTETGIDVNGREEEEEVGEEGSVIPDDGQGKL
PF10590         ----RLHdRlrytre.eeegWvv-----------------------------------------------
PF10590         ----RLHdRlrytre.eeegWvv-----------------------------------------------
PF01243         -kdGrPsaspvllkygdgrdgiyfatnkdsrk-------------------------------------l
PF01243         -kdGrPsaspvllkygdgrdgiyfatnkdsrk-------------------------------------l
PF01243         -kdGrPsaspvllkygdgrdgiyfatnkdsrk-------------------------------------l


                         -         -         *         -         -         -         -:140
query           EGNRWAALTFNWPSVERQVRVEGLIEMLSREESETYWRVRERGSQIGAWASQQSKVLWSTEPRDMEGVDA
PF10590         ----------------------------------------------------------------------
PF10590         ----------------------------------------------------------------------
PF01243         eenpkvsllfvddeeagrqvrieGraeilsde--------------------------------------
PF01243         eenpkvsllfvddeeagrqvrieGraeilsde--------------------------------------
PF01243         eenpkvsllfvddeeagrqvrieGraeilsde--------------------------------------


                         +         -         -         -         -         *         -:210
query           VPGAASRLKDINSQSGEEDDGRSVLENRVKEMEKRFADTEEIPLPPFWGGVRLVPESVEFWQGRKSRLHD
PF10590         -----------------------------------------------WGGyrvvPesiEFWqgrtsRLHd
PF10590         -----------------------------------------------WGGyrvvPesiEFWqgrtsRLHd
PF01243         ---------------------------------------------------------------------e
PF01243         ---------------------------------------------------------------------e
PF01243         ---------------------------------------------------------------------e


                         -         -         -         +         -         -         -:280
query           RFRYVRVHGENEHLGEGDEKTFRWRIQRLSP---------------------------------------
PF10590         Rlrytre.........eeeg.....WvverL---------------------------------------
PF10590         Rlrytre.........eeeg.....WvverL---------------------------------------
PF01243         agrqvrieGraeilsde-----------------------------------------------------
PF01243         agrqvrieGraeilsde-----------------------------------------------------
PF01243         agrqvrieGraeilsde-----------------------------------------------------