[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00774


[Show Plain Result]

## Summary of Sequence Search
   1::714
  29::39   PF08159 0.0% 54.5454545454545  NUC153 domain 
  54::66   PF08159 0.0% 53.8461538461538  NUC153 domain 
 626::655  PF08159 0.0% 36.6666666666667  NUC153 domain 
   1::714


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPESSAMKKSPKRRKTSSNDKADKDVITDPRFANIQSDPRYRLPSKKHTRVKIDKRFAHMFHDKDFSRNA
PF08159         ----------------------------DpRFkalFedp--------------DpRFkalFedpdF----
PF08159         ----------------------------DpRFkalFedp--------------DpRFkalFedpdF----
PF08159         ----------------------------DpRFkalFedp--------------DpRFkalFedpdF----


                         -         -         *         -         -         -         -:140
query           AVDRYGRKLRRDDTKKQLEKFYRLDKDDVEGQISADDDEEVQKELLRVEKEDYDPARDGGFSESSSSEES
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SSDEESEAELQDEAAESGQLDSQTGDIPLGEITDRIAVVNLDWDNIRAEDLMAVFSSFLPTGGKILNVAV
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YPSEFGKERMEREEMEGPPKEVFAKRDAEVDSDVEAGDDEEEEEKIKQAILKEDEGQDFDSTQLRKYQLE
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RLRYFYAVLTCSSKDAAKHIYDTVDGTEYMSSANFFDLRFVPESTDFAEDVPRDECNRIPDGYKPNEFVT
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DALQHSKVKLTWDTDDKARKDAQARAFKGGKKEIDENDLKAYLGSDSSDSEEEHVEVVDSTEAAGASTKL
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SKKEAERARIRALLGLSNDAPSKAKEKGPVGDMEVTFAAGLTAAPARDSVFENEPEKEETTREKYIRKER
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ERKQRRKAKLKAAKSGTVPEIDADKPTAESKEEEDLGFDDPFFTAPELDSAKVAAKRKEEKRKQRQQREA
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DGAASAAQRAELELLMMDDKTSTIKHFDMNEIEKAQKRAKKAGKHRKGKKDEATMPVDDFKVDVKDPRFQ
PF08159         -----------------------------------------------------------------DpRFk
PF08159         -----------------------------------------------------------------DpRFk
PF08159         -----------------------------------------------------------------DpRFk


                         -         +         -         -         -         -         *:700
query           RIYESHEYAIDPTNPRFRQTDGMKALLEEGRKRRRHLAHDEPDGDAVEPIKKKKRGKTAGPDRMPETEDL
PF08159         alFedpdFaiDetspeFkklnpsek---------------------------------------------
PF08159         alFedpdFaiDetspeFkklnpsek---------------------------------------------
PF08159         alFedpdFaiDetspeFkklnpsek---------------------------------------------


                         -         -         -         -         +         -         -:770
query           SKLVEQVKAKAKMV--------------------------------------------------------
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------
PF08159         ----------------------------------------------------------------------