[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00779


[Show Plain Result]

## Summary of Sequence Search
   1::1773
 867::895  PF02985 0.0% 17.2413793103448  HEAT repeat 
 907::932  PF02985 0.0% 26.9230769230769  HEAT repeat 
 947::965  PF02985 0.0% 31.5789473684211  HEAT repeat 
1286::1300 PF02985 0.0% 53.3333333333333  HEAT repeat 
   1::1773


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQQQRQPGLAVVIQGNGTSSRASQRLPRPLSVDEALQYSPMTSAPVFGLDSIMRPDVGQPSLSGWPRPYD
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SQVAGRITDSLDNETQASSGLGESTRLETAREYLQQLLRQDNLTDFNFKVPPSLRSDSSPQKNGESLSRS
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QLGPFAKLILDSTDATFHYSTPTTTNSEKHHQSSNTLPTPLSSSKPPYSANKEDQMRQQLEKLMKPMVII
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PGLAPSSNIEDFKYVSGEGSAKRRKLDSNNEEKQDPLPLRDQKELSDTALVKLQSLLHEIFEAEEQLLPD
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           APLDAQAGGKFFKFPNTIGDLGPIMSSETHEVLSKALQKVSDYRRLGDIPTEYIKHIQRLCEAPIMAVQS
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ADFKLESPPSDTDIERWITQLEDVQNALLAIITLLQTMPGNQSTKDLCPEDLIHAIPTALGQVFDHCIIP
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VVECRSSGKDSTHFHVFSAQKQVISNVIHQTKRVLSRLAVFLSNVDLAEGPITAIEFLAARLIFVENAPN
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DKESAIGVQKYEASRRAAMDVLAKIFAKYPEQRPFILDEILVSLEKLPSNRQSARQFKLIDGKSIQLLSA
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LVIQLVQTTALRQTSSRLTVAKGSLQKATNSLDESDEEDEEDSNNGSERKTSPIKQLSKQVELLYDNAIH
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SAQYVTKFIVQRAMTSTKSGDQPYRNLLDIFTEDLISVLGSTDWPGAELILRVLASQMITIADHDKSSAN
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AKNMSLELLGWMGSAISDLTSTAQHLSNTLEDGHTDLTDHLRNLFHDYSNRALHIQDIVSLDGPYRMTLE
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           YLEEGDLGSWQLSSARGYLIAQWAKLVCSGYEDSAQGGSTKNPQGAGKLAKALSHILSNPKWLESNSAFD
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           RISTQQARFAYLIIVLSSGFCKGFDTIVKVLLNSITSDQAKVRSRSLKSVIHMLERDPSLLDRDGSVISL
PF02985         --------------------------llPlllkllnDpdpeVReaAaeaLgalae-----------llPl
PF02985         --------------------------llPlllkllnDpdpeVReaAaeaLgalae-----------llPl
PF02985         --------------------------llPlllkllnDpdpeVReaAaeaLgalae-----------llPl
PF02985         --------------------------llPlllkllnDpdpeVReaAaeaLgalae-----------llPl


                         -         -         -         +         -         -         -:980
query           ILRCATDSSPMVRDSALSLIAKCMFLKPGLEENCCRAILACSSDPTVGVRKRAIGLMKDVYIQTSNQELK
PF02985         llkllnDpdpeVReaAaeaLga--------------lllkllnDpdpeVReaAae---------------
PF02985         llkllnDpdpeVReaAaeaLga--------------lllkllnDpdpeVReaAae---------------
PF02985         llkllnDpdpeVReaAaeaLga--------------lllkllnDpdpeVReaAae---------------
PF02985         llkllnDpdpeVReaAaeaLga--------------lllkllnDpdpeVReaAae---------------


                         -         *         -         -         -         -         +:1050
query           LTIIEQLLLRVTDYESSVAVQASQALEEIWFSPLHSSFTESTQGTPQSKVSLKNLMNLIVGSVRRNEGVI
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           ATFEAFVKDELSAEAKSASLNFNVCKAVVAAMFDRIIHDSDKTDKRTLQSLLQSITVFARANAKLFTPDQ
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           LETLHPYIGHLSNADDLMLFRSVVVIYRCVLPYLSTSHNTLLKDIQNDLFKSVSKLARTELNEVMACLWT
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           INGVLQNTERLVKLTISVLKGINQAVSAKVDPSTSADVLGRVRSYIRIAGCVGKHCDLESFLAFFSQSFP
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           HMKATSVSGLMVDFISPFASSKYPHELRVMALESLGAICETWPAQYSREPAKIAFTSVFEEDSPDLQNIV
PF02985         -------------------------eVReaAaeaLgalae------------------------------
PF02985         -------------------------eVReaAaeaLgalae------------------------------
PF02985         -------------------------eVReaAaeaLgalae------------------------------
PF02985         -------------------------eVReaAaeaLgalae------------------------------


                         -         +         -         -         -         -         *:1400
query           LKGFLAFFSIHEGKSEKLIQTKDTNGKSEGSTRLGGSLKASENDGAAALIAQHFLQQMLHAALSKEDSHA
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           LTGIELIASINRQGLIHPKECAGVLVALETSTNASIANVAFETHKMLHQQHESMFDREYMRAVQDAFYYQ
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:1540
query           RDVVGDPTGASTRPFTAKLAALFEIIKISNSKYQKKFLTNLCSKVDFQPRALDVAGSPPEHMLLARFVCQ
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:1610
query           NLAYFEYAQIGELLATVACMERIVASTGTTVAHAIETDIFPVKIDCPNEQMQVDGAAADQAPHSVDPNSL
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:1680
query           KQLATAAATLSMLWETRTYLRRLYGVGFHSMPKESKASAKDLNKSLTKVQGIGGDRLWDAISKTMASLEN
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1750
query           TEGMTRVCREFATLMSIDDELRVAADDDRDGNDSAADFGNMSAMLGATNGSRPSKRRSSVSSGNAPKRPR
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1820
query           QKGRPKNTKKRGSTDSEQDGDFD-----------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------