[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_00781


[Show Plain Result]

## Summary of Sequence Search
   1::335
  36::62   PF03130 0.0% 36.3636363636364  PBS lyase HEAT-like repeat 
  76::100  PF03130 0.0% 32  PBS lyase HEAT-like repeat 
 108::130  PF03130 0.0% 43.4782608695652  PBS lyase HEAT-like repeat 
 184::196  PF03130 0.0% 46.1538461538462  PBS lyase HEAT-like repeat 
 204::231  PF03130 0.0% 29.1666666666667  PBS lyase HEAT-like repeat 
 242::267  PF03130 0.0% 38.4615384615385  PBS lyase HEAT-like repeat 
 274::292  PF03130 0.0% 52.6315789473684  PBS lyase HEAT-like repeat 
  91::119  PF02985 0.0% 55.5555555555556  HEAT repeat 
 127::144  PF02985 0.0% 40  HEAT repeat 
 227::253  PF02985 0.0% 22.2222222222222  HEAT repeat 
 258::286  PF02985 0.0% 48.1481481481481  HEAT repeat 
 295::314  PF02985 0.0% 40  HEAT repeat 
   1::335


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASTIADNADNNGNSKDSVQYLRKVLTSESSPLAQRFRALFSLKHLASSKPPTEETLPAIEAIAAAFSSP
PF03130         -----------------------------------RraAakaLgqlgd.....eeaipaLle--------
PF03130         -----------------------------------RraAakaLgqlgd.....eeaipaLle--------
PF03130         -----------------------------------RraAakaLgqlgd.....eeaipaLle--------
PF03130         -----------------------------------RraAakaLgqlgd.....eeaipaLle--------
PF03130         -----------------------------------RraAakaLgqlgd.....eeaipaLle--------
PF03130         -----------------------------------RraAakaLgqlgd.....eeaipaLle--------
PF03130         -----------------------------------RraAakaLgqlgd.....eeaipaLle--------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------
PF02985         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SALLKHELAYCLGQTRNLDTVPHLRKVLEDTQEDAMCRHEAAEALGALGDAGSLDILQRLRDDESEEEVV
PF03130         -----raAakaLgqlgdeeaipaLleaLqd-------RraAakaLgqlgdeeaipaLlea----------
PF03130         -----raAakaLgqlgdeeaipaLleaLqd-------RraAakaLgqlgdeeaipaLlea----------
PF03130         -----raAakaLgqlgdeeaipaLleaLqd-------RraAakaLgqlgdeeaipaLlea----------
PF03130         -----raAakaLgqlgdeeaipaLleaLqd-------RraAakaLgqlgdeeaipaLlea----------
PF03130         -----raAakaLgqlgdeeaipaLleaLqd-------RraAakaLgqlgdeeaipaLlea----------
PF03130         -----raAakaLgqlgdeeaipaLleaLqd-------RraAakaLgqlgdeeaipaLlea----------
PF03130         -----raAakaLgqlgdeeaipaLleaLqd-------RraAakaLgqlgdeeaipaLlea----------
PF02985         --------------------lPlllkllnDp..dpeVReaAaeaLgala-------lklln.Dp..dpeV
PF02985         --------------------lPlllkllnDp..dpeVReaAaeaLgala-------lklln.Dp..dpeV
PF02985         --------------------lPlllkllnDp..dpeVReaAaeaLgala-------lklln.Dp..dpeV
PF02985         --------------------lPlllkllnDp..dpeVReaAaeaLgala-------lklln.Dp..dpeV
PF02985         --------------------lPlllkllnDp..dpeVReaAaeaLgala-------lklln.Dp..dpeV


                         +         -         -         -         -         *         -:210
query           RETCDIAVDRILWETSKDSKSEKLKQSDFTSIDPAPPLPLSSAEQSIPELKQILLDASLPLFKRYRAMFA
PF03130         -------------------------------------------eeaipaLleaLqd-------RraAaka
PF03130         -------------------------------------------eeaipaLleaLqd-------RraAaka
PF03130         -------------------------------------------eeaipaLleaLqd-------RraAaka
PF03130         -------------------------------------------eeaipaLleaLqd-------RraAaka
PF03130         -------------------------------------------eeaipaLleaLqd-------RraAaka
PF03130         -------------------------------------------eeaipaLleaLqd-------RraAaka
PF03130         -------------------------------------------eeaipaLleaLqd-------RraAaka
PF02985         ReaA------------------------------------------------------------------
PF02985         ReaA------------------------------------------------------------------
PF02985         ReaA------------------------------------------------------------------
PF02985         ReaA------------------------------------------------------------------
PF02985         ReaA------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LRDMCSPPDLPTAVPAIEALAEGFKDRSALFRHEIAFVFGQLSHPASIPSLVATLSDKNEVGMVRHEAAE
PF03130         Lgqlgd....eeaipaLleaL----------RraAakaLgqlgdeeaipaLleaLqd------vRraAak
PF03130         Lgqlgd....eeaipaLleaL----------RraAakaLgqlgdeeaipaLleaLqd------vRraAak
PF03130         Lgqlgd....eeaipaLleaL----------RraAakaLgqlgdeeaipaLleaLqd------vRraAak
PF03130         Lgqlgd....eeaipaLleaL----------RraAakaLgqlgdeeaipaLleaLqd------vRraAak
PF03130         Lgqlgd....eeaipaLleaL----------RraAakaLgqlgdeeaipaLleaLqd------vRraAak
PF03130         Lgqlgd....eeaipaLleaL----------RraAakaLgqlgdeeaipaLleaLqd------vRraAak
PF03130         Lgqlgd....eeaipaLleaL----------RraAakaLgqlgdeeaipaLleaLqd------vRraAak
PF02985         ----------------lPlllkllnDpdpeVReaAaeaLgala----lPlllkllnDp..dpeVReaAae
PF02985         ----------------lPlllkllnDpdpeVReaAaeaLgala----lPlllkllnDp..dpeVReaAae
PF02985         ----------------lPlllkllnDpdpeVReaAaeaLgala----lPlllkllnDp..dpeVReaAae
PF02985         ----------------lPlllkllnDpdpeVReaAaeaLgala----lPlllkllnDp..dpeVReaAae
PF02985         ----------------lPlllkllnDpdpeVReaAaeaLgala----lPlllkllnDp..dpeVReaAae


                         -         *         -         -         -         -         +:350
query           ALGSLGAEDGVEETLKRFVNDPETVVRDSIIVALDMAEYEKSGEQEYILEQPVAA---------------
PF03130         aLgqlgdeeaip----------------------------------------------------------
PF03130         aLgqlgdeeaip----------------------------------------------------------
PF03130         aLgqlgdeeaip----------------------------------------------------------
PF03130         aLgqlgdeeaip----------------------------------------------------------
PF03130         aLgqlgdeeaip----------------------------------------------------------
PF03130         aLgqlgdeeaip----------------------------------------------------------
PF03130         aLgqlgdeeaip----------------------------------------------------------
PF02985         aLgala--------llkllnDpdpeVReaAaeaL------------------------------------
PF02985         aLgala--------llkllnDpdpeVReaAaeaL------------------------------------
PF02985         aLgala--------llkllnDpdpeVReaAaeaL------------------------------------
PF02985         aLgala--------llkllnDpdpeVReaAaeaL------------------------------------
PF02985         aLgala--------llkllnDpdpeVReaAaeaL------------------------------------