[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_01210


[Show Plain Result]

## Summary of Sequence Search
   1::551
 366::461  PF00581 0.0% 31.0344827586207  Rhodanese-like domain 
   1::551


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEQSSPLAAMQPPSVMLRHHFRSEAKAGCSSFPAVRKFGPDSFNFRDLSMKTGHSDYFNTKALRGSSPTV
PF00581         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SLAADLSQNFHIDKSPQLATPRRSLFTASLFGPENGRDNMTTPPLPSSSPAPNMEIMDMSPLPHKIPYCH
PF00581         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NADLDLDSPTTEISLAKSQQVHAQLSLEDSPMDLEPPGRPQRHKPPILRPSLMRSKAYSSGDKGSLAPQP
PF00581         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PPFRFAAGSSKPTACSSLSLSEMFEQSPPRESSPRFLTSISMGPPRPRAPFSGVVGQCRSNGSPVNGIRK
PF00581         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SSNPFCRPRKQSRRSLSMFEHPEDIVNQEEDTIMSSPGLQPIADIDSQPTLQLPHFIPEDGPDQLPRVES
PF00581         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SVLVDIINGKYNDCYDKIMIIDCRFEYEYEGGHINGAVNYTDKEHLAAELFDQEPKPSTALIFHCEYSAH
PF00581         ---------------ekvvllDvRspeeyekghIpgAvnvpldslypkrdlpfkdklaeeleesgkkldk


                         -         -         +         -         -         -         -:490
query           RAPIMAKYIRHRDRAVNVDIYPKLTYPEMYILNGGYSSFFAEHRALCYPQNYVEMSAKEHEFACERGLGK
PF00581         kktvvvycs.sgnrsggaaalllalilkelgyk........-----------------------------


                         *         -         -         -         -         +         -:560
query           VKQRSKLSRAQTFAFGQNSLQIEESPTGRCRPVGDRSCDPDAPFDRDVEVTRLPGRRMFSY---------
PF00581         ----------------------------------------------------------------------