[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_01225


[Show Plain Result]

## Summary of Sequence Search
   1::252
 118::187  PF00076 0.0% 37.6811594202899  RNA recognition motif. (a.k.a. RRM, RBD, or RNP dom 
   1::252


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDPETEAQIAQWQSAYMSKDESNQIAASNGKAGVGRRDDASSATGANTGPLGNIQRLQDGSTISTPPSVA
PF00076         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QTTSTTPIPGQPNAPNQSGPGKTVMRSGGGQTWTDSTLLEWDPAHFRLFCGNLAGEVTDDSLLKAFSKYP
PF00076         -----------------------------------------------lfVgnLppdvteeeLkelFskfG


                         +         -         -         -         -         *         -:210
query           SVQKARVIRDKRTEKSKGYGFVSFSDGEDYFRAAREMQGKYIGSHPVLLRRAMTEIRPVVVGKGGAKGHK
PF00076         piesiklvrd.etgrskgfafVeFeseedaekAlealngkklggrel-----------------------


                         -         -         -         +         -         -         -:280
query           KGGNTSGSGAGGGKASKAGGKAPDSGIQKKQAKTKGGLRVLG----------------------------
PF00076         ----------------------------------------------------------------------