[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_01300


[Show Plain Result]

## Summary of Sequence Search
   1::908
   2::236  PF10033 0.0% 44.8888888888889  Autophagy-related protein 13 
   1::908


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQNYHTKAALVILHSRVDLSPATYHGVIRTNKWFNVEVNETEDLKDSLGVWKYSNCTDSRPPPLIIEVYL
PF10033         -qnfflKaaqiIlqsRleltpesaessaesssekknkwFnleleesdalkeelklwrslddlesrlppli


                         -         -         *         -         -         -         -:140
query           DLTQLTNNQSLVIIDDSGKRWDVVEALATYGCLDNSRTSKSGVILERWRIDLGPGPDDLPLDMGSILPTV
PF10033         ietyLdlsqlssnqslvllddegkrwdvlks..........rtkkqeivLErWlieldessntesessss


                         +         -         -         -         -         *         -:210
query           YKKSIVVFRSLYAYSKLLPAWKYSKRHSKIRPNPALSLKYRILQGPGGQIRSTNDPLTVPLHPGNGPVVD
PF10033         eelptiYkrsivlfRsLytllrllPayklskrlkkssaqasalnigcrildgekpisskgriglskplid


                         -         -         -         +         -         -         -:280
query           TYSFGVTDSPAGPLSALVTYRTNCDFRVDDSEALLSSRFMGVDERFFKPSLPSEDNFAAAGQEHGSLPVQ
PF10033         seeasmetysfgpvetpvGrlsisVs--------------------------------------------


                         -         *         -         -         -         -         +:350
query           KRDVGRPDLGQAYGSMSTFHQVGATTGASPISALRAARELAAGSPSSPTRPSHSPRPSQAGRVAALSGEG
PF10033         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           NHLIQRRPSISIQPFKAPPLSASPALVDSPVGSQPKNSAPRVGPMDITSSARQMPPPHGTPTTSRRSAHV
PF10033         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SESAIASSTSGSPRPAPISKYSSSFSHRRGRLSSGGASKTDDDNNSSGRVSVSSSTVHPGSGTSADPATT
PF10033         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SSGSLQADEDNISDFLKMLEMGKDLLSRKDSKSLDKNTKRTSAALSRFQKMRDSNAVLSDSMSSSLLLQP
PF10033         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           SSISSSKQLPNAATSVAGASISVSSSPGKAISPHTQHIPAVPSRLSSNSVVDYSHSHEDRHERRHRLSHE
PF10033         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SRRSPSEERANDEPRLKRDESTANAIDIPTSPRPFIPSFRRSSSAAQRRSSPPVEDDLGDFLPFGMRSLS
PF10033         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LGAEDRSTLSLSELVRQQESSVPASDTNALQQQNQKDTRTGQSIVDESPSRIDNVPGTSSPRQYQPRFAH
PF10033         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           GRGRGSFGHPQPHVSAASSLGRASPIPNVTDADRERYIGSGNNGGTAVPPDTRRGSSHRFSFNRHLGTPA
PF10033         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           NMDEDEPLLFAMSDFGASRRSLEEGRKGATTAGADHGGAPSTELQPAAETRSEGGPPSVSRGRYRAWP--
PF10033         ----------------------------------------------------------------------