[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_01629


[Show Plain Result]

## Summary of Sequence Search
   1::694
 204::402  PF06371 0.0% 28.2758620689655  Diaphanous GTPase-binding Domain 
   1::694


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MESEAKDPSAENGSKQKKPKKTKSTTSLSGIFKRSQRGKKGNSCEKEDKENVTMARGSNDMPPPPIPRSR
PF06371         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AQSIQSQISSRYVSSGRTVEEEMSLYTPRGYSPSSQRNFYDFQQPSLTKRPDSKWRPKSEYGSSSTSSVK
PF06371         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DILQSIHRRSPSAGSVKSNASRTHPLAERPPSEKRKSSNGNRGSRVMAAIAAFSAKDKNFDKPKPVDPKE
PF06371         ---------------------------------------------------------------kp.deee


                         -         -         -         +         -         -         -:280
query           IDSEFERLLDARNIPHNMRDRMRSLNTNIKADFINKNQIEGECSSASASAQRQFVTTSHKRTKSKDSSFG
PF06371         idklFaelleelnlpeekreqmlalpiekKwqlvvqdkkteaqke.........................


                         -         *         -         -         -         -         +:350
query           RSENRGTKKRPKSADLSIPSRLPSGGLNPALPSPDLIADPTDFVHYLKEVQKPEIVEVSKLHKLRILLRN
PF06371         ........................eklskskseseeeespesyvkklkddslse....klLesLrVaLrs


                         -         -         -         -         *         -         -:420
query           ETISWVESFISHGGMEQLVDLLYRILKVEWREEHEDVLLHEVLLCIKALCTTSPALHQLCKIGDDLFPTL
PF06371         qplsWvkrFieleGlvaLlniLskinekkseseedlkreyeiikClKalmNn------------------


                         -         -         +         -         -         -         -:490
query           LRMLFGEEKKGPSEFATRNIIISLLFSHLSSATFEEVATRARTILSYMHDPKPPKESAPLPFIAEMHQAR
PF06371         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           PYQLWCKEMSNVTKEVFWIFLHHFNVVPVAKAEDSSLPFIQRYFPPPHTPVPAAPYIGGVEWDATNYLAT
PF06371         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           HLDLINGLLASLPTIEERNELRTHLRASGLEKVMGRSLRTCKEKLYPAVHEALKVWVSAAADDEWDYQFV
PF06371         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           REGPPRDAPPSTPRSPIKGCGSPKKLGIVGDAPPKIDFHVGISGNSNARNEQNRSQGLVNDGWI------
PF06371         ----------------------------------------------------------------------