[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_01663


[Show Plain Result]

## Summary of Sequence Search
   1::108
   1::108


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAWQRHKAQKAQISFANFLFLLSTSRFGCAQHPNSNGNMPGMGSRAVRLMYGPKTNHTEVTSVLTKAKMS


                         -         -         *         -         -         -         -:140
query           FQLPFASVRCKPFPTRQRNLPYDEWHWAPTVSYKRAGS--------------------------------