[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_01668


[Show Plain Result]

## Summary of Sequence Search
   1::628
  45::455  PF00723 0.0% 28.25  Glycosyl hydrolases family 15 
 518::608  PF00686 0.0% 46.1538461538462  Starch binding domain 
   1::628


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMLSILRALYAVPLVYSLVSGSEAKFALRQEETLEQWLETESSYALQSILDNIGDDGAKVQGAHAGIVVA
PF00723         --------------------------------------------rldlylrnvkrlillaqnpvtGlliA
PF00686         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFH
PF00723         SpstsdpDYrytWvRDsvyvilavwglgyrdedrakayeleqslvklmrglleamvrqagkvekfketqs
PF00686         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEE
PF00723         tkgLhakyftktgstvvGddewghlQlDatslyllalaqm....tasg..lqiistldevafvqnlvdYi
PF00686         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VQGSSFFTAIAQHRALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLL
PF00723         eaayktpdfglWEenqgeselnassvgmakAlleAideadlfgakgdaqlvektkdeilnklqgkygckr
PF00686         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GIIHNFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLA
PF00723         gfwplfntylildgsfaedkeqvqeyrealdasllllpelyfvpaddvdeeyqnpqsprllaqslyilds
PF00686         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNVARK
PF00723         llsegflavgeldpl...vrRysedvkpdklglsGrpyylctlwtvedlldelyekagkgrlwglvryal
PF00686         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDVPPTCLATSAAGSYQT
PF00723         glleklveskqltvGlppe.resvisaplpveela-----------------------------------
PF00686         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ATITGWPSTLTPTPTPTNPAPCPTPSSVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYE
PF00723         ----------------------------------------------------------------------
PF00686         ---------------------------vsvtfkvnattqlgenvyivGnvpeLGnWdpakaiklsaseet


                         -         -         -         *         -         -         -:630
query           ASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRSYTVPKNLEYQRRPSSSPAIQQRAKLPPH--
PF00723         ----------------------------------------------------------------------
PF00686         ssyplWsgtvslpagteieyKyikkdsdgsvtWesgenrsltvpssgt----------------------