[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_01675


[Show Plain Result]

## Summary of Sequence Search
   1::270
 126::255  PF10349 0.0% 36.036036036036  WW-domain ligand protein 
  27::51   PF11605 0.0% 32  Vacuolar protein sorting protein 36 Vps36 
  67::88   PF11605 0.0% 36.3636363636364  Vacuolar protein sorting protein 36 Vps36 
   1::270


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGRPTCPQKPPKRSILSRLHPNSWVMLHETDGFVRLPNERLIYTSPLRTTISLQALNPRPGDESLSLQSS
PF10349         ----------------------------------------------------------------------
PF11605         --------------------------lnrqnGrlyLTthrliyvdsadpkk---------------lnrq
PF11605         --------------------------lnrqnGrlyLTthrliyvdsadpkk---------------lnrq


                         -         -         *         -         -         -         -:140
query           NGRVHLTNQRIVYLPVQPTPQFQSFSAPLLNLHDTFVSAPFFGPNVWSAIVQPVVGGGIPPSNTAVQVKM
PF10349         -------------------------------------------------------gGGwegq...aefKl
PF11605         nGrlyLTthrliyvdsad----------------------------------------------------
PF11605         nGrlyLTthrliyvdsad----------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TFKEGGAFDFHSAFERIKERLQQVVEQARENGMISERSSQRDGAYSGVNFTNVHLDELPAYEGPSPTSSS
PF10349         tFkkGGaieFaqamvkaasraqravplssengw..........lyiivnlaaavleplpayeaYgaPpma
PF11605         ----------------------------------------------------------------------
PF11605         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FPPPFSGCSNPGNDLHSSQNTRHTPHEERFDPPTEPPPGYEEAQQQGVANDLEARLRRAQ----------
PF10349         gygappgg......ygappggygappagneapmagyqepPPgYee-------------------------
PF11605         ----------------------------------------------------------------------
PF11605         ----------------------------------------------------------------------