[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_01687


[Show Plain Result]

## Summary of Sequence Search
   1::385
  87::369  PF06999 0.0% 32.8767123287671  Sucrase/ferredoxin-like 
   1::385


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASIFRRGLEYLSPSASPAPSSVSDYEATSVPATGKPAVASKVITAQSPSTLFTVVDPTVDGEDCDHDCA
PF06999         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SCTIKYPAKFSVDYEDELYGHVKGWATHVLVATGKTDWVRDVADEKGSVMEAIERGGVSAKNGALKLSAS
PF06999         ----------------plagtaksydkhllvetgpedWksealdekaavlqala.salaenkkklkvkip


                         +         -         -         -         -         *         -:210
query           NIPVPDEYYHHPEGEQPTTVLLLPAFTIIDHVTPALVPNLIRQFVDLSPTTTTPLSDVMQIAGQEEPTEQ
PF06999         lssssgkiansslpetkrskkgevlllpdfieikllpenlkeefvealldekeeal..............


                         -         -         -         +         -         -         -:280
query           TPSDINIPERPPLDLKDLSESLPTSLRSRPCSHAAVILLCSQKTRDARCGQSAPLLRREFERHLRPLGLY
PF06999         ...............eallrqkllskkklegnreeknarivLvCsHgkrDkrCgitGplLkkefeaelae


                         -         *         -         -         -         -         +:350
query           RDLHDERPGGVGIYFISHVGGHKYSANVIVYRRRNFEWFKEGKDDCSNNVESMEKEGASQGIWLARVRPE
PF06999         kglqddr.........valvSHiGGHkFAgnvliy............lkkt.............pegiwy


                         -         -         -         -         *         -         -:420
query           DCEGIVKFTVLQGKVVKPGLQLRGGFDREKGLISW-----------------------------------
PF06999         Grvepehveaivqetiekg---------------------------------------------------