[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_01746


[Show Plain Result]

## Summary of Sequence Search
   1::195
  16::181  PF09774 0.0% 52.317880794702  Caffeine-induced death protein 2 
   1::195


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRPSTTRPTLTPQFCFNQRALRDFLRISRSTIDDSITQNLNALVTPARKGFDPASTTARQTDFANKTQI
PF09774         ---------------ClnsselrefLrlsRkaiDDtItqkLNelkkeaseeskt...............n


                         -         -         *         -         -         -         -:140
query           DPENCEIFKNKVLFPSWQVRSDVLNYCAGVATSPDPEDPDLVLRQVESAKDRERLVDERLDPYSARFFPR
PF09774         aeeaCkelleevLvpswqaRsevikfCakvaaslkkedpdkllsqqeskkerekavderldpyaaralkk


                         +         -         -         -         -         *         -:210
query           EARTESLAMLIRNERGVETIIRSRTWGMVTERCGNSFEGWEDALNRWREQQDQGK---------------
PF09774         eaeteslanllqnersvEeIirertlevlkerCklsskdle-----------------------------