[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02126


[Show Plain Result]

## Summary of Sequence Search
   1::598
 215::254  PF00782 0.0% 20.5128205128205  Dual specificity phosphatase, catalytic domain 
 275::392  PF00782 0.0% 35.3448275862069  Dual specificity phosphatase, catalytic domain 
   1::598


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPLPSLKSSHQDQGSVNQSFLRPMSPNANPGPTESSNRRAKNLKNLSLRLPASPFRPPLSTAPIAESGRH
PF00782         ----------------------------------------------------------------------
PF00782         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LSEPSSPVRPHSRGSKRRPPNLTIQTPGFQRPYSSNGTRVVPPTPSVRPTLRHIESSPSLNSILSPTHTN
PF00782         ----------------------------------------------------------------------
PF00782         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PMMPAPFPSKPFSLGTWCDADLGKASNQTNFNPNEPLIEFGEEDDCPISRESRKGSERGYPDGPIRIYDS
PF00782         ----------------------------------------------------------------------
PF00782         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GLWLYLEPNEEEASKFDVVFNVAKEVNNPFSTDGPKHDTVMSVWKATLAQSNAALRGEDPDTACSELSFK
PF00782         ----gskstaslalleklgitlvinvtkevpkn.nadkkseiey--------------------eklgit
PF00782         ----gskstaslalleklgitlvinvtkevpkn.nadkkseiey--------------------eklgit


                         -         *         -         -         -         -         +:350
query           SALESLSDECPPTPKANRPEPEYIHVPWDHNSEILDDLFPLCEIIDNRISKGKRVLIHCQLGVSRSASLV
PF00782         lvi.nvtkevpknnadkkseieylripvedetetkiskeleeavefiekaeqkgkkvlVHCqaGisRSat
PF00782         lvi.nvtkevpknnadkkseieylripvedetetkiskeleeavefiekaeqkgkkvlVHCqaGisRSat


                         -         -         -         -         *         -         -:420
query           IAYGLYKNTHLDFNAVYGMVKERSCWVGPNMSLIYQLTDFRTKIRGGTITRSPADYNEAMRTAQSSHTQT
PF00782         liiaY.lmktknlslneAyefvkerrskispnagflrqLley----------------------------
PF00782         liiaY.lmktknlslneAyefvkerrskispnagflrqLley----------------------------


                         -         -         +         -         -         -         -:490
query           TDIEREIAHSKAAASTPNNGKPVVDPSKLFTQVNPFSPDTSSNRVRRHITPRPLPLREKFHTIHSLRNSP
PF00782         ----------------------------------------------------------------------
PF00782         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           CHDGPTATTATTTTTTTTTTTFQRPSVRSALQMDLVMQDVPPSPSFFSPKASEFIAAPFPRSKAGDITFE
PF00782         ----------------------------------------------------------------------
PF00782         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KFANLQSPNLVRRPSMNDPRSPQRRAEPIIMRSIDEFL--------------------------------
PF00782         ----------------------------------------------------------------------
PF00782         ----------------------------------------------------------------------