[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02186


[Show Plain Result]

## Summary of Sequence Search
   1::567
 124::269  PF01565 0.0% 24.6268656716418  FAD binding domain 
 516::555  PF08031 0.0% 32.5  Berberine and berberine like 
   1::567


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASQAEFVTPSAVNATMKASAVVGHRQRCSYGDSCWPTEGEWQSFNASVSGHLIRTYPSAAVCHAERYDD
PF01565         ----------------------------------------------------------------------
PF08031         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AKCTAAKENWLDSFWRTNQTGAYSAILWELGENGQCFIDSPRDAPCDQGIVPHYSVNIQSTSDIQTAVKF
PF01565         -----------------------------------------------------avvrpeseeevaaivrl
PF08031         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVY
PF01565         arekglpvlvrGgGssllgqav.tggvvldlsrlnrileide...........eegtatveaGvtlgdle
PF08031         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RAAAENGVIVVGGSARTVGAAGGYLTGGGHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYA
PF01565         ealaakglllglepgslipgtvGGaiatngggygsekyGlirdnvlslevvladGevvr-----------
PF08031         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LRGGGGSAWGVITSVTYKTHPSPSHIQVGLVQFNVTNNSTLRAVIEKCLQELPSITDAGYTGYGSMNFLS
PF01565         ----------------------------------------------------------------------
PF08031         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GGKEPLGFGAIFIQPNGTNATFTRTFKPYYDIAKMQGVSGALANIDFPSWIEYAEVFVQDPNIATNIIDG
PF01565         ----------------------------------------------------------------------
PF08031         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SRLLTSQALLHRTRDLVDLMFEYASFGPGFNFIGKVSSAKRDETSTHPIWEQSRALLSFAANWRDDASAN
PF01565         ----------------------------------------------------------------------
PF08031         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EKRNAKLSLVEISKKLGDIVGPGGGTYVNEANPYEPDWQNVFWGEKYARLLAIKKRIDPTNLFVCNRCVG
PF01565         ----------------------------------------------------------------------
PF08031         -------------------------aYvNyrdldlgarewgekYfggNyerLvkvKtkyDPdnvF-----


                         -         -         -         *         -         -         -:630
query           TDIVLEP---------------------------------------------------------------
PF01565         ----------------------------------------------------------------------
PF08031         ----------------------------------------------------------------------