[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02192


[Show Plain Result]

## Summary of Sequence Search
   1::682
 128::243  PF09405 0.0% 40  CASC3/Barentsz eIF4AIII binding 
   1::682


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAPHHRRRLPASRRRIEDEGEEDGSVAGDFEDDSLSEASSHQDEDPEGEGSDFSDNDFPASPESRKDERV
PF09405         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ESRTQKEANCSSPTKTPFAAKVSETEAMLNGMKLADDTAGVAEIHFDDMASEHDASPDLSDKATRLPQSQ
PF09405         ---------------------------------------------------------eeeeked....ke


                         +         -         -         -         -         *         -:210
query           RRRREQTENGKERGANPAFVPTRGGFFLHDKRSSNSPNGYRTANNKLKSKPHGLIVDSNVRRPPPKPDIT
PF09405         rkrseaekkededrenPafvPkrGaFflHDdRsaeteangvrefeks..srvrglivdskvrrrklkdsa


                         -         -         -         +         -         -         -:280
query           DGPWTHDLHESVNEGPPPASSRPSSTLPSNMPSGQSSKPVPTAPRSTPPNRSFSSTVLIGNVPVVVFLPG
PF09405         tedkWsHDrfeevaeeqapksraelvsaygydi-------------------------------------


                         -         *         -         -         -         -         +:350
query           MANPIPYSAVPKKQHTRLPQHRPPLRRDKPVRIALPGSPPRYIFPSTERSFIFIPRALRPNQQAYRGRGR
PF09405         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GGFYSSRRSSLYGGTVYTPSLPMSRRSSVGRVASRNGMISPGGSVMSRPPIMAGEAGKPVVRLPPVGRGP
PF09405         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LPAGPMAPPPAPPSVASAAGAVPQPLAQPSPYTPQHPQFRENRPTPTIPMHQPRPQKTVSVADIESPMSL
PF09405         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           YNPPQQLEQPFHHQVPMALNGPPYGPETAGYSSHTRNVSHPPQASATPLSQIPERAIHAPPFQPYPYQQP
PF09405         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           QNYYPSASYPSGPVGYPGPNPDYPQYSAPVPPGPTPVFVPAGQQAPYGMPSQPTTEQFTQSGTVAHESNG
PF09405         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           TVYYYDASQYPNYPNATYPVAPQGGVVGMGGMITPPGTYYYPQQPNGTVYYS------------------
PF09405         ----------------------------------------------------------------------