[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02520


[Show Plain Result]

## Summary of Sequence Search
   1::424
  63::358  PF03095 0.0% 45.8904109589041  Phosphotyrosyl phosphate activator (PTPA) protein 
   1::424


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASLPLPSSTSHKPTASLDLSKKLSSLRTNRRNPSALSSQAAAPPTPQLPDRPTLTQHQFIRPVPRILSP
PF03095         --------------------------------------------------------------pvkrilse


                         -         -         *         -         -         -         -:140
query           QDLETFLSSPAHSLIIAFVFNVSDSVRQQSVSSLVQLPVSETIRKVLSILSAIEELIDKHPSLDQNGSRF
PF03095         sdleefkkSkaykkilafikklseavkgkkls..kelkvseavekllellekleklidetppeekkpsrF


                         +         -         -         -         -         *         -:210
query           GNPAFRDLFDDIAAHSVQWHKDILGLDDPAAIEEVSTYLIHSLGSRSRLDFGSGHELNFMMWLLCLYLFG
PF03095         GnlafrdwhekleeeleelleellksekkealeelsaYllesfGsktrlDYGtGhELsFlafllclvklg


                         -         -         -         +         -         -         -:280
query           MLDRNDFPVIVCHVFIRYMKLMRHVQTTYYLEPAGSHGVWGLDDYHFIPFLFGAAQLTGHPYITPLAIHN
PF03095         ilkeedeeaivlkvfakYlelvrrLqktYtLepAgshGvwgLDdyqflpyilGaaQ.laekklkskpksi


                         -         *         -         -         -         -         +:350
query           NVVLDEEGDNWIYLDQVRWVDSVKTVKGLRWHSPMLDDISGAKNWYKVEAGMKKMFVKEVLGKLPIMQHF
PF03095         lkeevveeykeeylylsaiafinkvktg.pfrehSpmLydissvksWskvnkGlikmykaevLskfpvvq


                         -         -         -         -         *         -         -:420
query           LFGSLIPALPEMGERNEKAEQPDPGSGHPHGHAHSHQNDFWGDCCGIKVPSAVAAGEEMRKRQGGTGLRP
PF03095         hflfgsll--------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IPFD------------------------------------------------------------------
PF03095         ----------------------------------------------------------------------