[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02554


[Show Plain Result]

## Summary of Sequence Search
   1::149
  30::94   PF01176 0.0% 52.3076923076923  Translation initiation factor 1A / IF-1 
   1::149


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPKNKGKGGKNRRRGKNENDNEKRELTFKEEGQEYAQVVKMLGNGRLEALCFDGEKRLAHIRGKLRKKVW
PF01176         -----------------------------eegevigqVtkllGnnrfeVeledGeerlahipgKfrkkiw


                         -         -         *         -         -         -         -:140
query           INQGDIILLSLRDYQDEKGDVILKYSADEARSLKAYGELPESAKINETDTYGHEGLDDNVEFDEDRESAD
PF01176         ikrGDfVlVelspydktkgrIiyr----------------------------------------------


                         +         -         -         -         -         *         -:210
query           EKDIDIDEI-------------------------------------------------------------
PF01176         ----------------------------------------------------------------------