[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02566


[Show Plain Result]

## Summary of Sequence Search
   1::287
  16::175  PF02230 0.0% 27.2727272727273  Phospholipase/Carboxylesterase 
 203::282  PF02230 0.0% 40.7894736842105  Phospholipase/Carboxylesterase 
 216::273  PF00326 0.0% 28.3018867924528  Prolyl oligopeptidase family 
   1::287


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MALNMEAENRTFPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSS
PF02230         ---------------aiespkkpaqalvIllHGlGdsg.kllafaak........leaklpntkfifpha
PF02230         ---------------aiespkkpaqalvIllHGlGdsg.kllafaak........leaklpntkfifpha
PF00326         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQGMA
PF02230         peepvtlnggrrmpaWfdleelspek...kedeagikksaekieelidaelktg.ipssriilgGFSQGa
PF02230         peepvtlnggrrmpaWfdleelspek...kedeagikksaekieelidaelktg.ipssriilgGFSQGa
PF00326         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFD
PF02230         alalylaltspk....klagiialsgalplnqkle---------------------------lsgalpln
PF02230         alalylaltspk....klagiialsgalplnqkle---------------------------lsgalpln
PF00326         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAA
PF02230         qkleesatalakvpilllHGeeDpvvplalgkaakellkkllnkvelkeyeg...mgHsic.peelqdik
PF02230         qkleesatalakvpilllHGeeDpvvplalgkaakellkkllnkvelkeyeg...mgHsic.peelqdik
PF00326         -----vk..aypplllihGeeDdrvppaealklvaaLq..kagkn.vlllifpdegHgigkpr-------


                         -         *         -         -         -         -         +:350
query           FLESKTS---------------------------------------------------------------
PF02230         kf--------------------------------------------------------------------
PF02230         kf--------------------------------------------------------------------
PF00326         ----------------------------------------------------------------------