[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02911


[Show Plain Result]

## Summary of Sequence Search
   1::537
  24::104  PF10382 0.0% 43.2098765432099  Protein of unknown function (DUF2439) 
   1::537


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDCTPSARTTRPVAAGPSQTTAAVIRFSCLFTYDIKRKAKRWQDGFLRFHTFNRRVMVYGTSGDFVGDLH
PF10382         -----------------------vkeyevlYTtqirkKaKkWqDGflkfhefnnrvelydedgvllessf


                         -         -         *         -         -         -         -:140
query           MRESSTVRDGDQLELERGVLVEVGECLEKTETDLTELLEKRKTNSTASPARTMIQQTPAAAAAAAGVVAN
PF10382         lknseelkegeelelengyLvqieelieeterdv------------------------------------


                         +         -         -         -         -         *         -:210
query           PARPKSLNELLGKNRGPLGRAVLPRKSPFQLQRENDQDQHDHAAERPTKRRKLSPVVERQREGDASIASK
PF10382         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NLERISARKINDGGSTGINLASTTKPNQNDTSGGFQPASALKITSSSRAEHGRKGSKKALLGNQKAITAM
PF10382         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FHGDKRNITFPSPVENPRKKLMCLEISKKPKTGKKPAQRESTGSSWNTSIPGGGIEPSSSSSVTPLGGLS
PF10382         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RSEGEKMAVLTPTGGNSPMDYIPSTSTMRVLEESFHVSEAPPSPQKATRSISDFFKPNPPPPAIQEEKEN
PF10382         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TGSSPKPPSLLRSHSDIEALAQPTESTTLLSNPAPPHRHRTAANGLQKSLSDTSALRCRSSRPSRSLQTR
PF10382         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LMTVSGSCTPDSSRNDEEQGPWTSEALDLFDWWPPNRPKPGERGQEL-----------------------
PF10382         ----------------------------------------------------------------------