[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02920


[Show Plain Result]

## Summary of Sequence Search
   1::1547
   1::1547


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADSLPMYAAGAVGDNGVDLDDPFISSTPAGNHTQRELHRYSSFDAQLFTLNTSSPAQAKRALEAHLAET


                         -         -         *         -         -         -         -:140
query           ERRLEETSNLGTALIEQQRELMDKLKEVEQQHTDGEIGPDLRRKLNDLEREYNEIGRETARVALGPKVRL


                         +         -         -         -         -         *         -:210
query           TGQEDGLATPSLDSRHHASPSVFSSQATNSPSKVTVPSRKQRNQPSSRVHDIEFATEISTSLLAQVRQLQ


                         -         -         -         +         -         -         -:280
query           ALLAEREEAIKALTLEKSHLELEAEGFTQRLRALDESEQRYKDENWSLETQTHDLLAAAKEASDRESRLT


                         -         *         -         -         -         -         +:350
query           SNLNALTVEKNNIQRELDELKQANGRLVEENMATQKALDSELHILRRNITLGESERNALQQKVDELAGQN


                         -         -         -         -         *         -         -:420
query           QELAKAVAAKLRQHEADSAKDPNPEDNRKASDDLTPENSPPPSPNKPTPRHGLLESETLKSSLHHAHRMI


                         -         -         +         -         -         -         -:490
query           QTLKGTIHREKTEKIELKRMLQDARDELEQRRAEPVRPISSHNRRQKPKGDNFKKPARPEMLGAGRKGIT


                         *         -         -         -         -         +         -:560
query           QIEVAEPEWEDEGEPSPTRVARPNKRAVSYGNSGIESSTTSDAYQTANETEAFETANEREVTTESEAFQT


                         -         -         -         *         -         -         -:630
query           GTENFIDESSDDLTETESRTMHTGTIRPRRSGQLNSTRPMSFASTASTSGDEDEYIEVRTPVQHQPPRYR


                         -         +         -         -         -         -         *:700
query           IKMSRGRRGRVSQESHIRQGSVPLSPRDSPASLNSPPQSPRQREISGGQSLFAELSGLAGAGSDSEFGAP


                         -         -         -         -         +         -         -:770
query           LRSSTMSEMSTPSRRQSFATLADSSRPVTAREIVMVDSCTMTEPLPPAVPAQFEIVSPPESTSDYKDAET


                         -         -         *         -         -         -         -:840
query           STAPREGVDAFTTFERIVVIDSATQCMPIETPLLAKSEPAVTIDIAPEIPDTDANHESLHATIETLPSPV


                         +         -         -         -         -         *         -:910
query           MLPMEPTILDISPIYSEQTAPISPMPIDLQSRRPSVRMDMSVIAFEDSRPSLPAVTPSKSSLDLAMSSIQ


                         -         -         -         +         -         -         -:980
query           STSTNPLAVPVSLPESKRAQVLEFSTIFEVGTSPKEAIFPTVPPMTLEVSNIQCVESLPVKPVPTILSVE


                         -         *         -         -         -         -         +:1050
query           PPTDTLKLNGIEAQPCPPQVTDRATQSQISTMDRGISTSPLPKIETESQGSQTALTEVLETGERSSQVQI


                         -         -         -         -         *         -         -:1120
query           STAEISSQTILTGFQIDKLLMERQASRPVTAIESSQAQAAIISTQSSPLTTPKAKQLSSAQTGLLHPNNA


                         -         -         +         -         -         -         -:1190
query           TRRPGSSGSQRLGNSLSVPPLPVDHKQTIAAASQRLSSEASPSVMGPPIAPASSYRSSSQIRPRTPSEQP


                         *         -         -         -         -         +         -:1260
query           SRNSARNQSTPQTKFRRTSTSMASRRSSISSFASELDERFNIAKATYPFESGADPRMIQAITQTMIGEFL


                         -         -         -         *         -         -         -:1330
query           WKYTRKLGRSDMSNTRHQRYFWVNPYTRTLYWGPHDPQVLAKSQQRSKSVAIEAVRVVNDDNPYPPGLHR


                         -         +         -         -         -         -         *:1400
query           KSLEIITPGRTLKFTAATSQRHETWFNALSYLLLRTADDETEEQDVVWEAGSDYNATNGRNSRQAESRRS


                         -         -         -         -         +         -         -:1470
query           ISSHNSRAARTISKQFVETVPTLRRPVTPNQPSPSPSSRPGSSLRPDQTRPGSVTRISNVFRSSGIKSTF


                         -         -         *         -         -         -         -:1540
query           SSRRSRYGNASGSIDSTSAASNDSAEELRRVIERQDREADRLENVRACCDGKHDVSALSRTSRYSARISP


                         +         -         -         -         -         *         -:1610
query           LSHHVHS---------------------------------------------------------------