[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02972


[Show Plain Result]

## Summary of Sequence Search
   1::134
   4::133  PF06355 0.0% 50 PF06355 Aegerolysin 
   1::134


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGYQQWVIVKITNSTNKALKIANLRLMYGKIHREGNKDEEISADDVDSTEIAPNATYTLCTCGRSDSPSG
PF06355         ---aqwvkieirdslksgdlkirnaklesGkfhkeedkdkeiteddveeliiapggsgevcscGredaas


                         -         -         *         -         -         -         -:140
query           AEGALQLMQEQAAVCTLYWDCPWGSKTNNFEVQDRNKQYVVSAEGWVREGGALGTAEVEVFKKG------
PF06355         GteGtldlvdgekkictlyWdcpwgsksNkfevsdsdkkYkvetsgwnessgalgtVtveisr-------