[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_02989


[Show Plain Result]

## Summary of Sequence Search
   1::1343
 102::381  PF00664 0.0% 30.4029304029304  ABC transporter transmembrane region 
 776::1048 PF00664 0.0% 24.6212121212121  ABC transporter transmembrane region 
 470::604  PF00005 0.0% 37.3913043478261  ABC transporter 
1140::1267 PF00005 0.0% 34.7826086956522  ABC transporter 
 457::473  PF02463 0.0% 64.7058823529412  RecF/RecN/SMC N terminal domain 
 575::645  PF02463 0.0% 39.4366197183099  RecF/RecN/SMC N terminal domain 
1128::1143 PF02463 0.0% 50  RecF/RecN/SMC N terminal domain 
1237::1307 PF02463 0.0% 30.9859154929577  RecF/RecN/SMC N terminal domain 
 455::477  PF03193 0.0% 52.1739130434783  Protein of unknown function, DUF258 
 864::900  PF03193 0.0% 24.3243243243243  Protein of unknown function, DUF258 
1123::1148 PF03193 0.0% 44  Protein of unknown function, DUF258 
 552::606  PF09818 0.0% 35.1851851851852  Predicted ATPase of the ABC class 
1213::1268 PF09818 0.0% 40  Predicted ATPase of the ABC class 
 461::619  PF00004 0.0% 23.4567901234568  ATPase family associated with various cellular acti 
1130::1146 PF00004 0.0% 35.2941176470588  ATPase family associated with various cellular acti 
1220::1303 PF00004 0.0% 21.7948717948718  ATPase family associated with various cellular acti 
 459::494  PF00448 0.0% 33.3333333333333  SRP54-type protein, GTPase domain 
1128::1166 PF00448 0.0% 33.3333333333333  SRP54-type protein, GTPase domain 
 461::477  PF03215 0.0% 58.8235294117647  Rad17 cell cycle checkpoint protein 
1127::1146 PF03215 0.0% 60  Rad17 cell cycle checkpoint protein 
 461::481  PF07728 0.0% 47.6190476190476  AAA domain (dynein-related subfamily) 
1129::1150 PF07728 0.0% 45.4545454545455  AAA domain (dynein-related subfamily) 
 459::474  PF03205 0.0% 50  Molybdopterin guanine dinucleotide synthesis protei 
1129::1146 PF03205 0.0% 50  Molybdopterin guanine dinucleotide synthesis protei 
   1::1343


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAGDPEKPSETAAQLAVQKTSNSSPGTGPSSASGSTVGDGDNLKKLDSKLANEKRESNLDDSLAHLPEHE
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RDIIKQQLEIPETKVKFFTLYRYATTNDIIILLVSAVASIAGGAALPLFTILFGQMAGTFQRIILGTISY
PF00664         -------------------------------lllailllilagvtalvfplllgrllds.......vsdg
PF00664         -------------------------------lllailllilagvtalvfplllgrllds.......vsdg
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DEFNDTLSKYALYFVYLGIAEFVLIYTCTVGFIYTGEHIAQKIRERYLDAVLRQNIAFFDKLGAGEITTR
PF00664         ndeersslyslailliavgvlivlllqgsfyllertgqrirkrlfrallrkilglfdsffdknsvGells
PF00664         ndeersslyslailliavgvlivlllqgsfyllertgqrirkrlfrallrkilglfdsffdknsvGells
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ITADTNLIQDGISEKVGLTLTALATFVTAFVIGFIKYWKLTLICCSTVVAIVTIMGGASRFIIRFSKKNV
PF00664         rltnDvskirdglgdklglffqslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkke
PF00664         rltnDvskirdglgdklglffqslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkke
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ESYGEGGTVAEEVLSSIRNATAFGTQEKLAKQYDAHLLEAQKWGTKLQMTIGIMVGGMMSIVFLNYGLGF
PF00664         qkayakagavaeEalsgirtVkafggeekeleryekaleeakkagikkaitagllfgftqlisylsyala
PF00664         qkayakagavaeEalsgirtVkafggeekeleryekaleeakkagikkaitagllfgftqlisylsyala
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           WMGSRFIVSGETELANIITILLAIIIGSFSLGNVTPNAQAFTSAIAAGAKIFSTIDRKSPIDPTSEDGET
PF00664         lwfgtflsvisgelsvgtvfaflslglqlsg---------------------------------------
PF00664         lwfgtflsvisgelsvgtvfaflslglqlsg---------------------------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LEKVEGNIEFRDIRHIYPSRPEVLVMKGVNLFVPAGKTTALVGPSGSGKSTVIGLLERFYNPVGGSVLVD
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         -------------------------------------------------STLlklltgelkptegeievd
PF00005         -------------------------------------------------STLlklltgelkptegeievd
PF02463         ------------------------------------sftaivGpNGSGKsnvl-----------------
PF02463         ------------------------------------sftaivGpNGSGKsnvl-----------------
PF02463         ------------------------------------sftaivGpNGSGKsnvl-----------------
PF02463         ------------------------------------sftaivGpNGSGKsnvl-----------------
PF03193         ----------------------------------kdktsvlvGqSGvGKSsLinall-------------
PF03193         ----------------------------------kdktsvlvGqSGvGKSsLinall-------------
PF03193         ----------------------------------kdktsvlvGqSGvGKSsLinall-------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------lyGppGtGKTllakavakel..........
PF00004         ----------------------------------------lyGppGtGKTllakavakel..........
PF00004         ----------------------------------------lyGppGtGKTllakavakel..........
PF00448         --------------------------------------illvGlqGaGKTTtlaKLAallkkegkkvllv
PF00448         --------------------------------------illvGlqGaGKTTtlaKLAallkkegkkvllv
PF03215         ----------------------------------------ltGPsGcgKsTtvkvls-------------
PF03215         ----------------------------------------ltGPsGcgKsTtvkvls-------------
PF07728         ----------------------------------------LvGppGtgKselaerlaealn---------
PF07728         ----------------------------------------LvGppGtgKselaerlaealn---------
PF03205         --------------------------------------vlvvGpkdsGKTTlie----------------
PF03205         --------------------------------------vlvvGpkdsGKTTlie----------------


                         *         -         -         -         -         +         -:560
query           GVDIQNLNLKWLRQQISLVSQEPTLFGTTIYNNIKQGLIGSPFELEPDQSVRQRIENAAKMANAHDFIMG
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ndrkdlesdkleklr..igyipqdpllfpeltvrenldmakeekk........tdkrieevlekvgldel
PF00005         ndrkdlesdkleklr..igyipqdpllfpeltvrenldmakeekk........tdkrieevlekvgldel
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         -------------------------------------------------------------vdispFinn
PF09818         -------------------------------------------------------------vdispFinn
PF00004         gvefleisgsellsk.......................................................
PF00004         gvefleisgsellsk.......................................................
PF00004         gvefleisgsellsk.......................................................
PF00448         aaDt------------------------------------------------------------------
PF00448         aaDt------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LPEKYETHVGERGFLLSGGQKQRIAIARAIVSDPKILLLDEATSALDTKSEGVVQAALDEASKGRTTIII
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ldk..........srvstLSgGqkqrvalArallkkpklllLDE--------------------------
PF00005         ldk..........srvstLSgGqkqrvalArallkkpklllLDE--------------------------
PF02463         --------------lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQ
PF02463         --------------lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQ
PF02463         --------------lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQ
PF02463         --------------lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQ
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         LPegkdtt.efstedASGStsqAanimealeagakllLiDEDtsAt------------------------
PF09818         LPegkdtt.efstedASGStsqAanimealeagakllLiDEDtsAt------------------------
PF00004         .............yvgesekkirelfkeakekapsvlfiDEidalaksrgseseeeerv-----------
PF00004         .............yvgesekkirelfkeakekapsvlfiDEidalaksrgseseeeerv-----------
PF00004         .............yvgesekkirelfkeakekapsvlfiDEidalaksrgseseeeerv-----------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           AHRLSTIKTADNIVVLVDGRIVEQGTHDELVERDGTYLRLVEAQRINEERDAQAMADSDDGEESPMGSDA
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         fivislreemlekad-------------------------------------------------------
PF02463         fivislreemlekad-------------------------------------------------------
PF02463         fivislreemlekad-------------------------------------------------------
PF02463         fivislreemlekad-------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           DALRLQKSITAASNASARFADEKMDLELQKTETKKSLSSVILSKREPEKDKEYGLGTLIKFISSFNAAEW
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           KLMVTGLAVSIICGAGQPTMAVFFSKCISALALPPPLYDKLRSDANFWCLMFLMLGIVMFFAYSIQGSLF
PF00664         -----ailllilagvtalvfplllgrllds.......vsdgndeersslyslailliavgvlivlllqgs
PF00664         -----ailllilagvtalvfplllgrllds.......vsdgndeersslyslailliavgvlivlllqgs
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           AYCSEKLIYRARSKAFRSMLRQDIAFFDVDENSTGALTSFLSTETKHLSGISGVTLGTILMVTTTLAASM
PF00664         fyl..lertgqrirkrlfrallrkilglfdsffdknsvGellsrltnDvskirdglgdklglffqslatf
PF00664         fyl..lertgqrirkrlfrallrkilglfdsffdknsvGellsrltnDvskirdglgdklglffqslatf
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         -----------------------vlvlsvktkegleelaellkdktsvlvGqSGvGKSsL----------
PF03193         -----------------------vlvlsvktkegleelaellkdktsvlvGqSGvGKSsL----------
PF03193         -----------------------vlvlsvktkegleelaellkdktsvlvGqSGvGKSsL----------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           VVGLAIGWKLALVCISCVPVLLACGFYRFWILAAFQRRAKKAYEASASYACEATSAIRTVASLTREPDVS
PF00664         vgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqkayakagavaeEalsgirtVkafgge
PF00664         vgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqkayakagavaeEalsgirtVkafgge
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           GTYHGQLVVQGKKSLVSILKSSTLYAASQSFMFFVLALGFWYGGTLLGKGEYTLFQFFLAFSEVIFGAQS
PF00664         ekeleryekaleeakkagikkaitagllfgftqlisylsyalalwfgtflsvisgelsvgtvfaflsl--
PF00664         ekeleryekaleeakkagikkaitagllfgftqlisylsyalalwfgtflsvisgelsvgtvfaflsl--
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           AGTVFSFAPDMGKAKSAAADFKKLFDRRPPIDTLSKEGDDVEHIEGTIEFRDVHFRYPTRPEQPVLRGLN
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           LSVKPGQYVALVGPSGCGKSTTIALLERFYDTLSGGVYVDGTDITRWNVSAYRSFLALVSQEPTLYQGSI
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         -------------------STLlklltgelkptegeievdndrkdlesdkleklr..igyipqdpllfpe
PF00005         -------------------STLlklltgelkptegeievdndrkdlesdkleklr..igyipqdpllfpe
PF02463         -------ftaivGpNGSGKsnvl-----------------------------------------------
PF02463         -------ftaivGpNGSGKsnvl-----------------------------------------------
PF02463         -------ftaivGpNGSGKsnvl-----------------------------------------------
PF02463         -------ftaivGpNGSGKsnvl-----------------------------------------------
PF03193         --lkd.ktsvlvGqSGvGKSsLinallp------------------------------------------
PF03193         --lkd.ktsvlvGqSGvGKSsLinallp------------------------------------------
PF03193         --lkd.ktsvlvGqSGvGKSsLinallp------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ---------llyGppGtGKTllakav--------------------------------------------
PF00004         ---------llyGppGtGKTllakav--------------------------------------------
PF00004         ---------llyGppGtGKTllakav--------------------------------------------
PF00448         -------villvGlqGaGKTTtlaKLAallkkegkkvllvaaDtfR------------------------
PF00448         -------villvGlqGaGKTTtlaKLAallkkegkkvllvaaDtfR------------------------
PF03215         ------rillltGPsGcgKsTtvkvl--------------------------------------------
PF03215         ------rillltGPsGcgKsTtvkvl--------------------------------------------
PF07728         --------vlLvGppGtgKselaerlaeal----------------------------------------
PF07728         --------vlLvGppGtgKselaerlaeal----------------------------------------
PF03205         --------vlvvGpkdsGKTTliekl--------------------------------------------
PF03205         --------vlvvGpkdsGKTTliekl--------------------------------------------


                         *         -         -         -         -         +         -:1260
query           RDNILLGITEDDVPEEAIIEACKAANIYDFIMSLPDGFSTLVGSKGSMLSGGQKQRIAIARALIRDPKIL
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ltvrenldmakeekk.tdkrieevlekvgldelldk..........srvstLSgGqkqrvalArallkkp
PF00005         ltvrenldmakeekk.tdkrieevlekvgldelldk..........srvstLSgGqkqrvalArallkkp
PF02463         ----------------------------------------------elLSgGektLvalaLlfAiqkvkp
PF02463         ----------------------------------------------elLSgGektLvalaLlfAiqkvkp
PF02463         ----------------------------------------------elLSgGektLvalaLlfAiqkvkp
PF02463         ----------------------------------------------elLSgGektLvalaLlfAiqkvkp
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------kgvdispFinnLPegkdtt.efstedASGStsqAanimealeagakll
PF09818         ----------------------kgvdispFinnLPegkdtt.efstedASGStsqAanimealeagakll
PF00004         -----------------------------leisgsellsk......yvgesekkirelfkeakekapsvl
PF00004         -----------------------------leisgsellsk......yvgesekkirelfkeakekapsvl
PF00004         -----------------------------leisgsellsk......yvgesekkirelfkeakekapsvl
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           LLDEATSALDSESEKVVQVALDAAAKGRTTIAVAHRLSTIQKADVIYVFDQGRITESGTHSELLAKKGRY
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         klllLDE---------------------------------------------------------------
PF00005         klllLDE---------------------------------------------------------------
PF02463         aplyllDeidaaLDeknvskvaellkeksknaQfivislreemleka-----------------------
PF02463         aplyllDeidaaLDeknvskvaellkeksknaQfivislreemleka-----------------------
PF02463         aplyllDeidaaLDeknvskvaellkeksknaQfivislreemleka-----------------------
PF02463         aplyllDeidaaLDeknvskvaellkeksknaQfivislreemleka-----------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         LiDEDtsA--------------------------------------------------------------
PF09818         LiDEDtsA--------------------------------------------------------------
PF00004         fiDEidalaksrgseseeeervvnqLlteldglkkkeskvlvi---------------------------
PF00004         fiDEidalaksrgseseeeervvnqLlteldglkkkeskvlvi---------------------------
PF00004         fiDEidalaksrgseseeeervvnqLlteldglkkkeskvlvi---------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           YELVHMQSLGKTH---------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF09818         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF03215         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------