[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cimm2:CIRT_10408


[Show Plain Result]

## Summary of Sequence Search
   1::221
  27::114  PF00027 0.0% 44.3181818181818  Cyclic nucleotide-binding domain 
 171::207  PF00392 0.0% 32.4324324324324  Bacterial regulatory proteins, gntR family 
 171::199  PF00325 0.0% 31.0344827586207  Bacterial regulatory proteins, crp family 
   1::221


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDNDAPLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG
PF00027         --------------------------sfkkgeviikeGdpadslyiilsGkvkvykndedgkeqilaelg
PF00392         ----------------------------------------------------------------------
PF00325         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVARGLLAQLAGRLRKANDVVADLVF
PF00027         pGdffGelalltgeprtatvvaltdvellaipredfrelleknp--------------------------
PF00392         ----------------------------------------------------------------------
PF00325         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVI
PF00027         ----------------------------------------------------------------------
PF00392         ------------------------------kLPsereLaaefgVsrttvReALrrLeaeglverrqg---
PF00325         ------------------------------pmsRqeIAdylGlTrETVsRlLgrLrekg-----------


                         -         -         -         +         -         -         -:280
query           MDIERMARRAR-----------------------------------------------------------
PF00027         ----------------------------------------------------------------------
PF00392         ----------------------------------------------------------------------
PF00325         ----------------------------------------------------------------------