[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00332


[Show Plain Result]

## Summary of Sequence Search
   1::587
  16::537  7.7e-62 24.1% 0042501 00425011 1/1   eneral substrate transporter            
  24::544  8.8e-52 25.0% 0042480 00424801 1/1   eneral substrate transporter            
   1::587


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATLTAGGNSAFKNFHNQFAHIQDPNERRRLALAEIDKAPFGWYHIRAIVVAGIGFFTDAYDIFAINLAS
00425011   1/1  ---------------Msdsssseedd.......pelprpllrrrrwrillllflgyflagldrsiigpal
00424801   1/1  -----------------------Mkekrrrv.................llllflgyflsgldfgligpll


                         -         -         *         -         -         -         -:140
query           AMLGVVFWLDAKDKPGKIPSSADTAIKVATSGGTVIGQVGFGWLADVVGRKKMYGLELMVIIFATLAQAL
00425011   1/1  pll.edl.........glsaaqaglllsafflgyalgallaGplaDrfGrrrvlllglllfalgslllal
00424801   1/1  plilkdflglsaaqi.........gllfsayllgaalgsplaGrlsDrfGrrkvlllglllfalgsllla


                         +         -         -         -         -         *         -:210
query           SSDSPGVSIVGLLIFWRVIMGIGIGGDYPLSSIITSEFATTKWRGAMMGAVFAMQGIGQFAAALVALIVA
00425011   1/1  aallgps......lalllllrflqGlgagglfpaalallaewfppkergralglfgaggglGgalgpllg
00424801   1/1  faptysts......lwlllllrflqGlgagglfpaalaliaelfppeerglaleygllsaggslGallgp


                         -         -         -         +         -         -         -:280
query           AGFKESLKTAESESQCSGVCQVAVDKMWRVVIGFGAVPGCIALYYRLTIPETPRYTFDVQRDVVKGAEDT
00425011   1/1  gllleldlg.......................Wrwafliaailalllalllllllpesprflllkglsee
00424801   1/1  llggllld.lg.......................wrlvfliaailalllllllllflpesprf......l


                         -         *         -         -         -         -         +:350
query           KAYMLGKPEGSPDELQRIATLEQSQSQLQVPKASWSDFWTHYKQWKHGKVLLGTAGSWFFLDVAFYGLGL
00425011   1/1  erkvlerrlkad.......................................aeakaasplsllellrnpr
00424801   1/1  aakgklee............................ekkaslklslkellknpr....llllllavfllf


                         -         -         -         -         *         -         -:420
query           NNSIILSAIGYTGGKDMYEIMYNTAVGNLILICAGAIPGYWVTVATVDTLGRKPIQIMGFTMLTVLFIVI
00425011   1/1  ....flllllayfllflgfyglltflplylqevlglsas.........qaglllalfglggilgsllagr
00424801   1/1  lgfyalltylplylqslfevlgls.........asqaglllalfglggilgsllagrlsdrlgrrrllli


                         -         -         +         -         -         -         -:490
query           GFAYDKLLHSNNGLLALYVIAQFFFNFGPNSTTFIVPGECFPTRYRSTSHGLSAASGKVGAIIAQCVFGP
00425011   1/1  lsdrlpegrrrrllliglllaalgllllall....pgtslallllllfllgfglggafpllfalvaelfp
00424801   1/1  gllllalgllllal......apslwllllllillgfgfglafpllfallselfppelrgtalgllnllag


                         *         -         -         -         -         +         -:560
query           LVSRGAKPGSSEKPWLKHVMQIFALFMLCGLITSFLIPETKRKTLEELAGEVPETPNYDPVTAGHARREG
00425011   1/1  pelrgtasgllnlagnlggallgpllagllldat.........gyaa-----------------------
00424801   1/1  slggalgpllagllldal........gysaaflllaalallallllllllretk----------------


                         -         -         -         *         -         -         -:630
query           QQVKGGEETPETVSPDMQPNEKHTTIV-------------------------------------------
00425011   1/1  ----------------------------------------------------------------------
00424801   1/1  ----------------------------------------------------------------------