[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00337


[Show Plain Result]

## Summary of Sequence Search
   1::462
  87::421  1.4e-08 15.6% 0049498 00494981 1/1   -like ATPase domain                     
   1::462


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSSQRSAADLDTSRTKPHRPFQEDHAAVQRLEEAISHPGSVKINVKGAFIVDEQPTEQSRVVFDCRDGI
00494981   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HYEHKDIRLPHHTDVVSHVAVDIGGSLAKLVYFSPELGSSADGGRLNFLNFETERIDLCIDFLKQLKENH
00494981   1/1  ----------------gyvlgiDiGgtnirvalvdldgevlarvriptpnp.fdeildaiaelleeagld


                         +         -         -         -         -         *         -:210
query           RKLNGSAPGPLCIMATGGGAYKYYDRLKEELGVDIIREDEMECLIIGLDFFITEIPNEVFTYSETSPMEF
00494981   1/1  ilgigigvpgpvdddtgiltnlpwg.fdlkd.leealglpvvaleNDanaaalalllld..........e


                         -         -         -         +         -         -         -:280
query           AEARPDVYPYLLVNIGSGVSMVKVSAPRRFERVGGTSLGGGTFWGLMSLLTGARTFDEMLAMAELGDNSG
00494981   1/1  dlealfgagkglddgvvlilglGtGigvaglvlngkllrgingeaGhighlpggdfdlalldclcgnpgc


                         -         *         -         -         -         -         +:350
query           VDMLVGDIYGTDYTKIGLKSSTIASTFGKVFKMQRLAERSAQGSECLCESDSESERDVSQFRREDISRSL
00494981   1/1  lsleklas..........gpgllrllrllleklglegsll..............................


                         -         -         -         -         *         -         -:420
query           LFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAF
00494981   1/1  daeevfeaaragfdplalaildraarllaralanlalnlldpdgvvlgGgvaralpdlllspllrealee


                         -         -         +         -         -         -         -:490
query           LKRQPQDWGRRRSIENTAATRFAAYREELRSATKNGTELPPT----------------------------
00494981   1/1  k---------------------------------------------------------------------