[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00357


[Show Plain Result]

## Summary of Sequence Search
   1::755
 146::744  1.1e-58 23.3% 0042501 00425011 1/1   eneral substrate transporter            
 156::743  3.4e-52 22.1% 0042480 00424801 1/1   eneral substrate transporter            
   1::755


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAQDIPSDTIEISHSRSNENTASNDGETSEHRESSAPRKVTWKKFLGVEKDGPDLEAVLDDDNNYGPRDR
00425011   1/1  ----------------------------------------------------------------------
00424801   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           WTMGILSDKQTEEVPGTILLLTSSRNEPLGLRQQPARVSASSLPSPYPPSRSSSRNPAPQQKRTPDGKIV
00425011   1/1  ----------------------------------------------------------------------
00424801   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LDPQPEESLNDPLNWPQWRRDLALLSLGFYCMIGGGMTPILAAAFNDVSEEYNVSFQKVALTTGLYMLGL
00425011   1/1  -----Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpalpll.edlglsaaqagll
00424801   1/1  ---------------Mkekrrrvllllflgyflsgldfgligpllplilkdflglsaaqigllfsayllg


                         -         -         -         +         -         -         -:280
query           GIGSVVMSPTAILFGKRPVYIAGATMFIISAVWCALSPTYVSLVIARIFQGIAVSPVECLPSATIAEIFF
00425011   1/1  lsafflgyalgallaGplaDrfGrrrvlllglllfalgslllalaallgpslalllllrflqGlgagglf
00424801   1/1  aalgsplaGrlsDrfGrrkvlllglllfalgslllafaptystslwlllllrflqGlgagglfpaalali


                         -         *         -         -         -         -         +:350
query           LHERAYRVGIYTLLLLGGKNLIPLVSAAITEGLGWRWIFWVVAITIAFGLVLVFFFVPETFWDRTPRPRT
00425011   1/1  paalallaewfppkergralglfgaggglGgalgpllggllleldlgWrwafliaailalllalllllll
00424801   1/1  aelfppeerglaleygllsaggslGallgpllggllld.lgwrlvfliaailalllllllllflpesprf


                         -         -         -         -         *         -         -:420
query           KRPKARRSVSDIVAHSFRGRSPEPVTPTEIRQKARDASTQKKQKDLRVDFADDVKSDMRRSGEHPRDSDN
00425011   1/1  pesprflllkglseeerkvlerrlkad...........................................
00424801   1/1  laakgklee.............................................................


                         -         -         +         -         -         -         -:490
query           QVLDEKHVEGEPAGDTVAEGYFSVPPASALTPPSTEEDSTTRKDVLDLESARSQPVSRDISVDASADPLH
00425011   1/1  ......................................................................
00424801   1/1  ......................................................................


                         *         -         -         -         -         +         -:560
query           ASLQQIYTSNLRSKPPVSFSQSLKPWNGRIARDNWFRVMTRPFILFAYPAVLWSSMVYALSVGWLIVLSE
00425011   1/1  ....................................................aeakaasplsllellrnp
00424801   1/1  ................................ekkaslklslkellknprllllllavfllflgfyallt


                         -         -         -         *         -         -         -:630
query           AVAEIYRNKESYNFSALATGLVYISPFVGGILGTVVAGKVSDIIVRWMARRNGGIYEPEFRLVMSAPIAI
00425011   1/1  rflllllayfllflgfyglltflplylqev.........lglsasqaglllalfglggilgsllagrlsd
00424801   1/1  ylplylqslf......evlglsasqaglllalfglggilgsllagrlsdrl.............grrrll


                         -         +         -         -         -         -         *:700
query           CTAMGLMGFGWSAQEKEKWIVPTVFFGILSFGCTLGSTTSITFCVDSYRQYAGEALVTLNFSKNVLHGFV
00425011   1/1  rl.............pegrrrrllliglllaalgllllallpgt..slallllllfllgfglggafpllf
00424801   1/1  ligllllalgllllal......apslwllllllillgfgfglafpllfallselfppelrgtalgllnll


                         -         -         -         -         +         -         -:770
query           FSLFFVDWLHSDGAKTVFVALGGIHLACMLFSIPMYIYGKRARMWTVRKRLMEKF---------------
00425011   1/1  alvaelfppelrgtasgllnlagn.lggallgpllagllldatg--------------------------
00424801   1/1  agslggalgpllagllldalgysaaflllaalallalllllll---------------------------