[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00379


[Show Plain Result]

## Summary of Sequence Search
   1::390
  48::382  3.4e-76 39.7% 0048588 00485881 1/1   hondrial carrier                        
   1::390


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSFPAPSPDLSRGASRLKDGSEPRQSVMIQSGETDDVEVAPALETKSKPAVKPWAHFFAGAVGGMTAATL
00485881   1/1  -----------------------------------------------kkllsllkdllagglagavstlv


                         -         -         *         -         -         -         -:140
query           TSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQSHSILSLSRSAMVHFSETVQILRSIHVHEGWRALFKGLG
00485881   1/1  thPldtvKtrlqvqgellal....................glalkykglldalkkivreeGlrglyrGls


                         +         -         -         -         -         *         -:210
query           PNLTGVVPARAINFYVYGNGKRILNDYFGYIPTETPASIHLAAAAVAGIATGTATNPIWLVKTRLQLDKS
00485881   1/1  pallgvapysaiyfgtyellkkllldllgkddsgklsllalllagalAgavaalvtyPlevvktrlqaqg


                         -         -         -         +         -         -         -:280
query           NASNIPGRGRQYKNSLDCIRQTVRHEGIRGLYRGLTASYLGVTESSLQWVMYEEMKRILARRAARRAADP
00485881   1/1  lla....ggerkykglldalrkiyreeGirglyrGlgptllrdvpysalyfalyellkelllkrkk....


                         -         *         -         -         -         -         +:350
query           AHVRGWTDTAEHWVGTITAAGSAKLLAAAATYPHEVVRTRLRQAPTIPAGGGKVQMKYTGLMQCFRVIWK
00485881   1/1  ............lsllvlflagalaglvaalltyPldvvktrlqvqgll....lggglkykgildclrki


                         -         -         -         -         *         -         -:420
query           EEGMAGLYGGLTPHLLRVVPSAAIMFGMYEMILRLCGTTS------------------------------
00485881   1/1  yreeGvrglykGlgprllrvvpa.aitflvyE--------------------------------------