[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00384


[Show Plain Result]

## Summary of Sequence Search
   1::406
  72::172  1.1e-11 26.3% 0047197 00471971 1/1   inding domain, RBD                      
  86::172  1.7e-11 27.4% 0049801 00498011 1/1   inding domain, RBD                      
  97::223  1.9e-11 26.4% 0047108 00471081 1/1   inding domain, RBD                      
 101::198  1.5e-10 27.8% 0052243 00522431 1/1   inding domain, RBD                      
  99::209  3.7e-10 27.2% 0052240 00522401 1/1   inding domain, RBD                      
  89::198  4.6e-10 30.7% 0052236 00522361 1/1   inding domain, RBD                      
 101::196  5.4e-10 31.0% 0052232 00522321 1/1   inding domain, RBD                      
 100::197  6.3e-10 28.3% 0048682 00486821 1/1   inding domain, RBD                      
 109::192  6.5e-10 29.9% 0049843 00498431 1/1   inding domain, RBD                      
 100::198  8.9e-10 29.0% 0050839 00508391 1/1   inding domain, RBD                      
  94::208    1e-09 29.1% 0050515 00505151 1/1   inding domain, RBD                      
 103::193  1.1e-09 29.4% 0037834 00378341 1/1   inding domain, RBD                      
  82::192  1.4e-09 27.9% 0047631 00476311 1/1   inding domain, RBD                      
  98::208  1.5e-09 27.2% 0049334 00493341 1/1   inding domain, RBD                      
  96::198  1.8e-09 25.8% 0049492 00494921 1/1   inding domain, RBD                      
 101::221  2.2e-09 25.9% 0046785 00467851 1/1   inding domain, RBD                      
  95::202  2.7e-09 30.4% 0041653 00416531 1/1   inding domain, RBD                      
 101::210  2.7e-09 26.0% 0048680 00486801 1/1   inding domain, RBD                      
 100::172  3.5e-09 28.6% 0052239 00522391 1/1   inding domain, RBD                      
 101::198  4.5e-09 28.3% 0050809 00508091 1/1   inding domain, RBD                      
 105::199  4.9e-09 27.9% 0046286 00462861 1/1   inding domain, RBD                      
 107::194  5.9e-09 30.5% 0045893 00458931 1/1   inding domain, RBD                      
  91::197  7.1e-09 25.7% 0052231 00522311 1/1   inding domain, RBD                      
 101::197  7.3e-09 29.2% 0036165 00361651 1/1   inding domain, RBD                      
  91::197  8.7e-09 27.0% 0050834 00508341 1/1   inding domain, RBD                      
 108::197  9.4e-09 31.0% 0053313 00533131 1/1   inding domain, RBD                      
 111::188  9.8e-09 36.1% 0050806 00508061 1/1   inding domain, RBD                      
 101::196  1.1e-08 28.9% 0052221 00522211 1/1   inding domain, RBD                      
 107::194  1.2e-08 29.3% 0046876 00468761 1/1   inding domain, RBD                      
 110::191  1.5e-08 33.3% 0047172 00471721 1/1   inding domain, RBD                      
  91::196  1.6e-08 26.0% 0052229 00522291 1/1   inding domain, RBD                      
 101::197  1.7e-08 33.0% 0052218 00522181 1/1   inding domain, RBD                      
 104::198  1.7e-08 30.2% 0052238 00522381 1/1   inding domain, RBD                      
  89::196  1.8e-08 25.7% 0050803 00508031 1/1   inding domain, RBD                      
 103::200  1.8e-08 29.7% 0049769 00497691 1/1   inding domain, RBD                      
 111::198  1.8e-08 32.9% 0052219 00522191 1/1   inding domain, RBD                      
 110::191  1.9e-08 32.0% 0047422 00474221 1/1   inding domain, RBD                      
 104::199  2.2e-08 29.9% 0050837 00508371 1/1   inding domain, RBD                      
  93::169  2.5e-08 31.5% 0050466 00504661 1/1   inding domain, RBD                      
 101::198  2.5e-08 27.8% 0052245 00522451 1/1   inding domain, RBD                      
 109::193  2.5e-08 32.1% 0048400 00484001 1/1   inding domain, RBD                      
  92::200  2.6e-08 25.7% 0046794 00467941 1/1   inding domain, RBD                      
 111::198  2.6e-08 31.7% 0050838 00508381 1/1   inding domain, RBD                      
 108::198    3e-08 29.4% 0046287 00462871 1/1   inding domain, RBD                      
 101::205  3.3e-08 27.3% 0050566 00505661 1/1   inding domain, RBD                      
 102::219  3.9e-08 25.9% 0049416 00494161 1/1   inding domain, RBD                      
  94::204  5.5e-08 24.3% 0050577 00505771 1/1   inding domain, RBD                      
  93::199  5.6e-08 28.1% 0046795 00467951 1/1   inding domain, RBD                      
 109::194  6.3e-08 31.2% 0046220 00462201 1/1   inding domain, RBD                      
 105::195  6.5e-08 29.8% 0052899 00528991 1/1   inding domain, RBD                      
 101::189  6.8e-08 26.7% 0052222 00522221 1/1   inding domain, RBD                      
  94::169  8.5e-08 26.8% 0050478 00504781 1/1   inding domain, RBD                      
  96::193  1.2e-07 25.3% 0045479 00454791 1/1   inding domain, RBD                      
 105::203  1.2e-07 27.8% 0045747 00457471 1/1   inding domain, RBD                      
 101::169  1.4e-07 30.8% 0052230 00522301 1/1   inding domain, RBD                      
 108::194  1.4e-07 30.9% 0052897 00528971 1/1   inding domain, RBD                      
 104::204  1.5e-07 26.1% 0050479 00504791 1/1   inding domain, RBD                      
 110::191  1.6e-07 30.7% 0045373 00453731 1/1   inding domain, RBD                      
  98::198  1.7e-07 30.1% 0052235 00522351 1/1   inding domain, RBD                      
  99::194    2e-07 25.3% 0042860 00428601 1/1   inding domain, RBD                      
 108::224  2.2e-07 25.9% 0052622 00526221 1/1   inding domain, RBD                      
  95::198  3.8e-07 28.4% 0050802 00508021 1/1   inding domain, RBD                      
 100::191  4.9e-07 29.1% 0052248 00522481 1/1   inding domain, RBD                      
 109::192    5e-07 32.0% 0052898 00528981 1/1   inding domain, RBD                      
  94::199  5.7e-07 18.8% 0050514 00505141 1/1   inding domain, RBD                      
  99::207  7.5e-07 22.9% 0051748 00517481 1/1   inding domain, RBD                      
 110::196  9.4e-07 30.1% 0052441 00524411 1/1   inding domain, RBD                      
 101::198    1e-06 25.6% 0052217 00522171 1/1   inding domain, RBD                      
 111::198  1.2e-06 32.0% 0050576 00505761 1/1   inding domain, RBD                      
  81::204  1.5e-06 23.9% 0050480 00504801 1/1   inding domain, RBD                      
 110::197  1.6e-06 32.1% 0049775 00497751 1/1   inding domain, RBD                      
  92::200  1.9e-06 23.7% 0050568 00505681 1/1   inding domain, RBD                      
 108::198  2.3e-06 29.1% 0052244 00522441 1/1   inding domain, RBD                      
  94::194  2.7e-06 22.1% 0049888 00498881 1/1   inding domain, RBD                      
 101::198  2.9e-06 26.7% 0052233 00522331 1/1   inding domain, RBD                      
  89::197    4e-06 25.8% 0052234 00522341 1/1   inding domain, RBD                      
  98::221    4e-06 21.4% 0042061 00420611 1/1   inding domain, RBD                      
 104::172  4.9e-06 28.3% 0050477 00504771 1/1   inding domain, RBD                      
  91::198  5.1e-06 25.0% 0050808 00508081 1/1   inding domain, RBD                      
  94::177  5.6e-06 24.0% 0050476 00504761 1/1   inding domain, RBD                      
 101::198  6.2e-06 25.6% 0052223 00522231 1/1   inding domain, RBD                      
  94::204    7e-06 24.7% 0050481 00504811 1/1   inding domain, RBD                      
  94::207  7.8e-06 26.0% 0050565 00505651 1/1   inding domain, RBD                      
 107::229  1.4e-05 25.0% 0048984 00489841 1/1   inding domain, RBD                      
 101::208  1.5e-05 24.2% 0050804 00508041 1/1   inding domain, RBD                      
 104::196  2.2e-05 29.1% 0052082 00520821 1/1   inding domain, RBD                      
 104::204  2.7e-05 28.4% 0050512 00505121 1/1   inding domain, RBD                      
  91::198  6.8e-05 26.0% 0050807 00508071 1/1   inding domain, RBD                      
 110::170  7.6e-05 38.9% 0052442 00524421 1/1   inding domain, RBD                      
 101::193  0.00012 22.9% 0050805 00508051 1/1   inding domain, RBD                      
 100::233   0.0002 24.5% 0050567 00505671 1/1   inding domain, RBD                      
 113::194   0.0009 28.8% 0052429 00524291 1/1   inding domain, RBD                      
   1::406


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATEDDNFDIDIYGDAGGYNGNENEGDYKVEEPELILDAPETSHQNGIGDGGASGGNNNATENGNHKIFK
00471971   1/1  ----------------------------------------------------------------------
00498011   1/1  ----------------------------------------------------------------------
00471081   1/1  ----------------------------------------------------------------------
00522431   1/1  ----------------------------------------------------------------------
00522401   1/1  ----------------------------------------------------------------------
00522361   1/1  ----------------------------------------------------------------------
00522321   1/1  ----------------------------------------------------------------------
00486821   1/1  ----------------------------------------------------------------------
00498431   1/1  ----------------------------------------------------------------------
00508391   1/1  ----------------------------------------------------------------------
00505151   1/1  ----------------------------------------------------------------------
00378341   1/1  ----------------------------------------------------------------------
00476311   1/1  ----------------------------------------------------------------------
00493341   1/1  ----------------------------------------------------------------------
00494921   1/1  ----------------------------------------------------------------------
00467851   1/1  ----------------------------------------------------------------------
00416531   1/1  ----------------------------------------------------------------------
00486801   1/1  ----------------------------------------------------------------------
00522391   1/1  ----------------------------------------------------------------------
00508091   1/1  ----------------------------------------------------------------------
00462861   1/1  ----------------------------------------------------------------------
00458931   1/1  ----------------------------------------------------------------------
00522311   1/1  ----------------------------------------------------------------------
00361651   1/1  ----------------------------------------------------------------------
00508341   1/1  ----------------------------------------------------------------------
00533131   1/1  ----------------------------------------------------------------------
00508061   1/1  ----------------------------------------------------------------------
00522211   1/1  ----------------------------------------------------------------------
00468761   1/1  ----------------------------------------------------------------------
00471721   1/1  ----------------------------------------------------------------------
00522291   1/1  ----------------------------------------------------------------------
00522181   1/1  ----------------------------------------------------------------------
00522381   1/1  ----------------------------------------------------------------------
00508031   1/1  ----------------------------------------------------------------------
00497691   1/1  ----------------------------------------------------------------------
00522191   1/1  ----------------------------------------------------------------------
00474221   1/1  ----------------------------------------------------------------------
00508371   1/1  ----------------------------------------------------------------------
00504661   1/1  ----------------------------------------------------------------------
00522451   1/1  ----------------------------------------------------------------------
00484001   1/1  ----------------------------------------------------------------------
00467941   1/1  ----------------------------------------------------------------------
00508381   1/1  ----------------------------------------------------------------------
00462871   1/1  ----------------------------------------------------------------------
00505661   1/1  ----------------------------------------------------------------------
00494161   1/1  ----------------------------------------------------------------------
00505771   1/1  ----------------------------------------------------------------------
00467951   1/1  ----------------------------------------------------------------------
00462201   1/1  ----------------------------------------------------------------------
00528991   1/1  ----------------------------------------------------------------------
00522221   1/1  ----------------------------------------------------------------------
00504781   1/1  ----------------------------------------------------------------------
00454791   1/1  ----------------------------------------------------------------------
00457471   1/1  ----------------------------------------------------------------------
00522301   1/1  ----------------------------------------------------------------------
00528971   1/1  ----------------------------------------------------------------------
00504791   1/1  ----------------------------------------------------------------------
00453731   1/1  ----------------------------------------------------------------------
00522351   1/1  ----------------------------------------------------------------------
00428601   1/1  ----------------------------------------------------------------------
00526221   1/1  ----------------------------------------------------------------------
00508021   1/1  ----------------------------------------------------------------------
00522481   1/1  ----------------------------------------------------------------------
00528981   1/1  ----------------------------------------------------------------------
00505141   1/1  ----------------------------------------------------------------------
00517481   1/1  ----------------------------------------------------------------------
00524411   1/1  ----------------------------------------------------------------------
00522171   1/1  ----------------------------------------------------------------------
00505761   1/1  ----------------------------------------------------------------------
00504801   1/1  ----------------------------------------------------------------------
00497751   1/1  ----------------------------------------------------------------------
00505681   1/1  ----------------------------------------------------------------------
00522441   1/1  ----------------------------------------------------------------------
00498881   1/1  ----------------------------------------------------------------------
00522331   1/1  ----------------------------------------------------------------------
00522341   1/1  ----------------------------------------------------------------------
00420611   1/1  ----------------------------------------------------------------------
00504771   1/1  ----------------------------------------------------------------------
00508081   1/1  ----------------------------------------------------------------------
00504761   1/1  ----------------------------------------------------------------------
00522231   1/1  ----------------------------------------------------------------------
00504811   1/1  ----------------------------------------------------------------------
00505651   1/1  ----------------------------------------------------------------------
00489841   1/1  ----------------------------------------------------------------------
00508041   1/1  ----------------------------------------------------------------------
00520821   1/1  ----------------------------------------------------------------------
00505121   1/1  ----------------------------------------------------------------------
00508071   1/1  ----------------------------------------------------------------------
00524421   1/1  ----------------------------------------------------------------------
00508051   1/1  ----------------------------------------------------------------------
00505671   1/1  ----------------------------------------------------------------------
00524291   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TEESGQPGKSASDNLQVPQQGVKRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKD
00471971   1/1  -leerddddtgrsrgygfvefssesggesasralsglnglslggrslkvgpsppspspeepppsrtlfvg
00498011   1/1  ---------------ldallalnglllagrlllvgpsllgkalslplaslpsedppsrtlfVgnLppdvt
00471081   1/1  --------------------------lllllleelellllvllllllllpallppeadppsrtlfVgnLp
00522431   1/1  ------------------------------lleesrdsrtlfvgnLpfdvteedLrelFskfg...evvs
00522401   1/1  ----------------------------ldssledlpsrtlfVgnLppdvteedLrelFskfG...evvs
00522361   1/1  ------------------rsglglllsllseesppsrt..lfvgnLppdvteedLrelfskfG...evvs
00522321   1/1  ------------------------------gpledppsrtlfvgnLppdvteedLrelfskfg...evvs
00486821   1/1  -----------------------------llgledppsrtlfvgnLppdvteedLrelfskfG...evvs
00498431   1/1  --------------------------------------rtlfvgnLpfdvteedLrelfskfg...evvs
00508391   1/1  -----------------------------llgledepsrtlfvgnLppdvteedLrelfskfg...evvs
00505151   1/1  -----------------------sslsslslplelrpsrtlfvgnLppdvteedLrelFskfG...evev
00378341   1/1  --------------------------------eedrssrtlfvgnLppdvteedLrelfskfg...evvs
00476311   1/1  -----------sglllllglllgpasssgllsersrdsttlfvgnLpfdvteedLkelfskfG...evvs
00493341   1/1  ---------------------------lllelsedlssrtlfvgnLpfdvteedLrelFskfG...evvs
00494921   1/1  -------------------------lgslslgsesppsrtlfvgnLppdvteedLrelfskfG...evvs
00467851   1/1  ------------------------------lpeedppsrtlfVgnLppdvteedllelLrelFskfG...
00416531   1/1  ------------------------gppssllsleprssrtlfvgnlpydvteedLrelfskfG...evks
00486801   1/1  ------------------------------lpeedppsrtlfvgnLppdvteedLrelfskfG...evvs
00522391   1/1  -----------------------------dssleslpsrtlfvgnLppdvteedLrelfskfg...evvs
00508091   1/1  ------------------------------lseedlesrtlfvgnLpfdvteedLrelfskf...Gevvs
00462861   1/1  ----------------------------------dppsrtlfvgnLppdvteedLrelfskfg...evvs
00458931   1/1  ------------------------------------psrtlfvgnLppdvteedLrelfskfg...evvs
00522311   1/1  --------------------llllglgsssspeeeppsrtlfvgnLppdvteedLrelFskfG...evvs
00361651   1/1  ------------------------------sseedlpsrtlfvgnLppdvteedLrelfskfG...evvs
00508341   1/1  --------------------lllaglgssslgeedppsrtlfvgnLppdvteedLrelFskfG...evvs
00533131   1/1  -------------------------------------srtlfvgnLpldvteedLrelfskfg...evvs
00508061   1/1  ----------------------------------------lfvgnLppdvteedLrelfskfg...evvs
00522211   1/1  ------------------------------spsesrssrtlfvgnLppdvteedLrelFskfG...evvs
00468761   1/1  ------------------------------------psrtlfvgnLppdvteedLrelfskfg...evvs
00471721   1/1  ---------------------------------------tlfvgnLpldvteedLrelfskfg...evvs
00522291   1/1  --------------------lgllglgsssspsesppsrtlfvgnLppdvteedLrelfskfG...evvs
00522181   1/1  ------------------------------gleedpdsttlfvgnLpfdvteedLrelFsk...fgevvs
00522381   1/1  ---------------------------------llepsrtlfvgnLppdvteedLrelfskfg...evvs
00508031   1/1  ------------------lglllssslssslseeerpsrtlfvgnLpfdvteedLrelFskfG...evvs
00497691   1/1  --------------------------------lapepsrtlfVgnLppdvteedLrelFskfG...evvs
00522191   1/1  ----------------------------------------lfvgnLppdvteedLrelfskfgevvsvri
00474221   1/1  ---------------------------------------tlfvgnLpldvteedLrelfskfg...evvs
00508371   1/1  ---------------------------------ldppsrtlfvgnLppdvteedLrelfskfg...evvs
00504661   1/1  ----------------------eglsslsslslpselrpsrtlfvgnLppdvteedLrelFskfG...ev
00522451   1/1  ------------------------------lgledppsrtlfvgnLppdvteedLrelfskfg...evvs
00484001   1/1  --------------------------------------rtlfvgnLpfdvteedLrelfskfg...evvs
00467941   1/1  ---------------------lllllslsllgeesrpsrtlfVgnLppdvteedLrelFskfg...evvs
00508381   1/1  ----------------------------------------lfvgnLppdvteedLrelfskfg...evvs
00462871   1/1  -------------------------------------srtlfvgnLppdvteedLrelfskfg...evvs
00505661   1/1  ------------------------------slsesppsrtlfvgnLppdvteedLrelfskfG...evvs
00494161   1/1  -------------------------------ledpppsrtlfVgnLpydvteedLrelFskfG...evls
00505771   1/1  -----------------------lssgssslssesrpsrtlfvgnLpydvteedLrelFskfg....vvs
00467951   1/1  ----------------------llglsssslseeerpsrtlfvgnLpfdvteedLrelfskfg...evvs
00462201   1/1  --------------------------------------rtlfvgnLppdvteedLrelfskfg...evvs
00528991   1/1  ----------------------------------dresrtlfvgnLppdvlteedLrelfskfg...eiv
00522221   1/1  ------------------------------lsvesldsttlfVgnLpldvteedLlelrelfskfGevvs
00504781   1/1  -----------------------lslgssgsssssresrtlfvgnLpysateedlrelFskfg....vvs
00454791   1/1  -------------------------pgssslgsedppsrtlfvgnLppdvteedLrelfskfG...evvs
00457471   1/1  ----------------------------------lppsrtlfvgnLppdvteedlkelLrelfskfG...
00522301   1/1  ------------------------------sssessssttlfvgnLpfsvteedLrelFskf...gevls
00528971   1/1  -------------------------------------sttlfvgnLppsvteedLrelfskfg...evls
00504791   1/1  ---------------------------------ldrssrtlfvgnLppdvteedLrelFskfG...evvs
00453731   1/1  ---------------------------------------tlfvgnLpldvteedLrelfskfg...evvs
00522351   1/1  ---------------------------llllpeldppsrtlfvgnLppdvteedLrelFskf...Gevvs
00428601   1/1  ----------------------------gssssseppsrtlfvgnLppdvteedLrelfskfg...evvs
00526221   1/1  -------------------------------------llelppsrtlfvgnLpydvteedLrelFskf..
00508021   1/1  ------------------------lllagllslelpdsrtlfVgnLppdvteedLrelFskf...Gevvs
00522481   1/1  -----------------------------llgsessssttlfvgnLpfdvteedLrelfskf...gevvs
00528981   1/1  --------------------------------------ttlfvgnLplsvteedLrelFskfg...evls
00505141   1/1  -----------------------sgsllsllslelrpsrtlfvgnLppdvteedLrelfskfG...evvs
00517481   1/1  ----------------------------sslslalppsrtlfVgnLppdvteedLrelfskfG...evvs
00524411   1/1  ---------------------------------------lrrlfVgnLpfdvteeeLrelFskfg.evvs
00522171   1/1  ------------------------------dssllppsrtlfvgnLppdvteedLrelfskfg...evvs
00505761   1/1  ----------------------------------------lfvgnLpfdvteedLrelfskfgevlsv..
00504801   1/1  ----------llnglllggrplrvspalpspspdpps.rtlfVgnLplpdvteedLrelFskfG...evv
00497751   1/1  ---------------------------------------lrtlyVgnLpfdvteedLrelFsk...fgev
00505681   1/1  ---------------------lllgggsslsssasppsrtlfVgnLppdvteedLrelFskfG...evvs
00522441   1/1  -------------------------------------sttlfvgnLppdvteedLrelfskfg...evvs
00498881   1/1  -----------------------gssgssvsgslgppsrtlfVgnlppdvteesllledlledLrelFsk
00522331   1/1  ------------------------------llsegppsrtlfvgnLppdvteeeLrelfspf...Gevvs
00522341   1/1  ------------------lllllldppslllssepppsrtlfvgnLppdvteedLrelFskf...Geves
00420611   1/1  ---------------------------knesgaellpsttlfvgnlppdvteedLkelFskfG...evks
00504771   1/1  ---------------------------------lsspsttLfvgnLppevflldeteedleelFskyg..
00508081   1/1  --------------------lllslsgssllseepppsrtlfvgnLppdvteedLrelfskfG...evvs
00504761   1/1  -----------------------gssgssgspsesppsrtlfvgnLppdvteedLrelfskfG...evvs
00522231   1/1  ------------------------------lgeesppsrtlfvgnLppdvteedLrelfskfG...evvs
00504811   1/1  -----------------------llsgssslssesrpsrtlfVgnLppedvteedLrelFskfG...evv
00505651   1/1  -----------------------lssgslgspeesppsrvlfvgnlpkevteedLrelFskf...Gnvls
00489841   1/1  ------------------------------------lpsrtlfvgnLppdlvteedLrelFskfG...ev
00508041   1/1  ------------------------------lgpsrrsgtrlfVgnLppdvteedLkdlfskfG...evvs
00520821   1/1  ---------------------------------ldresrtlfvgnlp..vteedLrelfskfg...evvs
00505121   1/1  ---------------------------------lsssstrlfvgnLpfdvteeeLrelfskfgevl....
00508071   1/1  --------------------lgslgspssllsleslpsrtlyvgnLpydlvteeeLrelfspfG...kvv
00524421   1/1  ---------------------------------------gaaelllptrvllldnmvltrlyvgnlpydv
00508051   1/1  ------------------------------ssselepsrvlfvgnlpydlvteedLrelfspfG...kvl
00505671   1/1  -----------------------------glspseerpsrtlfVgnLppdvteedLrelFskfG...evv
00524291   1/1  ------------------------------------------VgnLpldvteedLkelfskyg......k


                         +         -         -         -         -         *         -:210
query           VTFSEHKVNGKSKGQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGK
00471971   1/1  nLppdvteedLrelFskfG...evvsvrivrd--------------------------------------
00498011   1/1  eedLrelFskfG...evvsvrivrdkntgksk--------------------------------------
00471081   1/1  pdvteedLrelFskfG...evksvkivrdketgkskgfafVeFeseedAekA...lealngkeldgrplr
00522431   1/1  vrlvrdkntgrskgfafVeFeseedaekal.....lngkelggrplrvklakpkeerg------------
00522401   1/1  vrivrdketgrskgfafVeFedeedaekA...lealng.elggrplrvelakpkllrrlllggl.psgl-
00522361   1/1  vrivrdketgkskgfafVeFeseedaekA...le.lngkeldgrplrvelakpkserl------------
00522321   1/1  vrlvrdkntgrskgfafVeFeseedaeka...lealngklldgrplrvelakpkee--------------
00486821   1/1  vrlvrdkntgrskgfafVeFeseedaekA...lealngkeldgrplrvelakpkeer-------------
00498431   1/1  vrlvrdkltgrsrgfafVefeseedaekale....lnglllggrplrvelak------------------
00508391   1/1  vrlvrdketgkskgfafVeFeseedaeka...lealngteldgrplrvelakpkeerg------------
00505151   1/1  svrivrdk.tgkskgfafVeFeseedaekA...le.lngkelggrplrvelakpkelrlallg....l--
00378341   1/1  vrivrdketgrsrgfafVeFeseedaeka...lealngkllggrplrvelakp-----------------
00476311   1/1  vkvvrdk.tgkskgfafVeFeseedaekA...iealngrelggrplkvelak------------------
00493341   1/1  vrlvrdk.tgkskgfafVeFeseedaekA...le.lngkelggrplrvklakpkeerkrggrggglgg--
00494921   1/1  vrilrdkntgrsrgfafVeFeseedaekA...lealngkelggrplrvelakpkeerg------------
00467851   1/1  evvsvrilrd...gkskgfafVeFedeedaekA...lealngkeldgrplrvefakpkslrrgrgggrsg
00416531   1/1  vriprdkdgltgkskgfafVeFespedaekA...lealngrkldgrplrvelakpkkerrgr--------
00486801   1/1  vrivrdkntgrskgfafVeFedeedaekA...lealngkelggrplrvelakpkelrrglgggggggggg
00522391   1/1  vrilrdkntgrsrgfafVeFeseedaekalea--------------------------------------
00508091   1/1  vrivrdketgrskgfafVeFeseedaeka...lealngllllpgtlldgrplrvelak------------
00462861   1/1  vrlvrdketgrsrgfafVeFedeedaeka...lealngkeldgrplrvelakpkedrrg-----------
00458931   1/1  vrllrdketgrsrgfafVeFeseedaeka...lealngkllggrplrvelakpk----------------
00522311   1/1  vrivrdkntgrsrgfafVeFedpedaekA...lealngkelggrplrvelakpkeer-------------
00361651   1/1  vrilrd..tgkskgfafVeFeseedaeka...lealngkllggrplrvelakpkeer-------------
00508341   1/1  vrivrdk.tgrskgfafVeFespedaekA...lealngkelggrplrvelakpkeer-------------
00533131   1/1  vrlvrdketgkskgfafVefedeedaeka...lealnglelggrplrvelakpkeer-------------
00508061   1/1  vrlvrdkltgkskgfafVefeseedaeka...lealngllldgrllrV----------------------
00522211   1/1  vrlvrdknetgrsrgfafVeFeseedaeka...leallngtelggrplrvelakpk--------------
00468761   1/1  vrllrdkltgrsrgfafVeFedeedaeka...lealngklldgrplrvelakpk----------------
00471721   1/1  vrlvrdkltgkskgfafVeFeseedaekale....lnglllggrllrvelA-------------------
00522291   1/1  vrivrdketgrsrgfafVeFeseedaekA...lealngkelggrplrvelakpkee--------------
00522181   1/1  vkillllllllildketgkskgfafVeFespedaekA...iealngkelggrklrve-------------
00522381   1/1  vrlvrdketgksrgfafVeFeseedaeka...lealngteldgrplrvelakpkeerg------------
00508031   1/1  vrivrdkntgrskgfafVeFeseedaekA...le.lngtelggrplrvelakpkee--------------
00497691   1/1  vrivrdketgkskgfafVeFedeedaekAle....lngkeldgrrlrvelakpkksrsrg----------
00522191   1/1  vrklldketgkskgfafVeFespedaekA...lealngklldgrklrvelakpkderg------------
00474221   1/1  vrllrdketgrskgfafVefeseedaekale....lnglllggrplrvelA-------------------
00508371   1/1  vrilrdkntgksrgfafVeFeseedaeka...lealngkeldgrplrvelakpkedrdg-----------
00504661   1/1  vsgvrivrdk.tgkskGfafVeFeseeda-----------------------------------------
00522451   1/1  vrlvrd..tgkskgfafVeFedeedaekA...lealngkeldgrplrvelakpkeerg------------
00484001   1/1  vkilrdk.tgrsrgfafVefeseedaekA...lealngkllggrplrvelakp-----------------
00467941   1/1  vriv.dketgrsrgfafVeFeseedaekA...le.lngtelggrplrvelakpksdrggg----------
00508381   1/1  vrllrddketgkskgfafVeFedeedaeka...lealngkllggrplrvelakpkeer------------
00462871   1/1  vrllrdketgrsrgfafVeFeseedaeka...lealngkllggrplrvelakpkeerd------------
00505661   1/1  vrivrdkntgrsrgfafVeFespedaekA...lealngkeldgrplrvelakpkeerrrgggggg-----
00494161   1/1  vrilrdk....skgfafVeFedpedAekA...lealngteldgrplrvefakskslrlsvgrggggsrgl
00505771   1/1  vrivrdkletgrskgfafVeFeseedaekA...le.lngkelggrplrvelakpkeerrsgggg------
00467951   1/1  vri.....tgkskgfafVeFeseedaekA...lealngkeldgrplrvelakpkeerrg-----------
00462201   1/1  vrivrdkltgrskgfafVeFedeedaeka...lealngkllggrplrvelakpk----------------
00528991   1/1  svrilrdklstgrskgfafVeFeseedaekAle....lngkllggrplrvelakp---------------
00522221   1/1  vrivrdkntsgsgrsrgfafVtfeseedaekA...iealngtlldgrtl---------------------
00504781   1/1  vrlvrdk.tgrskgfafVeFaseedaekA-----------------------------------------
00454791   1/1  vrllrd.....skgfafVeFedeedaekA...lealngklllggrplkvefak-----------------
00457471   1/1  evvsvrvlrd...gksrgfafVeFedeedaekA...lealngkeldgrplrvelakpkedrrs-------
00522301   1/1  svrilrdk.tgrskgfafVeFeseedaek-----------------------------------------
00528971   1/1  vrlvrdrltgrsrgfafVeFeseedaeka...iealngkeldgrplrvelakpk----------------
00504791   1/1  vrivrd.....skgfafVeFedeedaekAl.....lngkeldgrplrvelakpkeerssglggg------
00453731   1/1  vrlvrdkltgrsrgfafVeFeseedaekale....lngkllggrllrvelA-------------------
00522351   1/1  vrivrd..tgkskgfafVeFeseedaekA...iealngkeldgrplrvelakpkderg------------
00428601   1/1  vrllrdk....skgfafVeFeseedaekAlealngkelggg..rplrvelakpk----------------
00526221   1/1  .Gevksvrivrd...grsrgfafVeFedpedaekA...lealngkelggrplrvelakpkeprlrlrggg
00508021   1/1  vrivrd...gkskgfafVeFedpedaekA...iealngtelggrplrvelakpksdrg------------
00522481   1/1  vrllrdketgrskgfafVeFeseedaekA...lealngkllggrplrvelA-------------------
00528981   1/1  vrilrd..tgkskgfafVeFeseedaekAle....lngtllggrllrvelak------------------
00505141   1/1  vrivrd.......gfafVeFedeedaekAlealngkeldsllgslrplrvelakpkldl-----------
00517481   1/1  vrilrd......kgfafVeFedeedaekA...lealngkelllggrplrvelakpkelrlklglgg.---
00524411   1/1  vrlvllkdketgksrgfaFVeFeseedaekA...lkalngteldgrplrvewakpk--------------
00522171   1/1  vri......lrdkgfafVeFedeedaekA...lealngklldgrplrvelakpkedrp------------
00505761   1/1  ........tgkskgfafVefeseedaekA...lealngtllggrplrvelakpkedrr------------
00504801   1/1  svriv........kgfafVeFedeedaekA...iealngkelggrplrvelakpkserssgggg------
00497751   1/1  vsvrilllllvldketgrskgfafVeFesvedaekAle....lngtelggrplrvkl-------------
00505681   1/1  vkvvrd......kgfafVeFedeedaekA...iealngkelggrplrvelakpkedrssg----------
00522441   1/1  vrl......grsrgfafVefedeedaekA...lealngkllldgrplrvelakpkser------------
00498881   1/1  yG...evvsvriv........kgyafVeFadeesaekAl.alngrelgg...rp----------------
00522331   1/1  vrllrd......kgfAfVeFedeedaekA...lealngtplllggrplrvefakpkel------------
00522341   1/1  vkllrd......kgyafVeFeseedaekA...iealngkelggrplrvewakpkser-------------
00420611   1/1  vkiird......kgfafVeFedeaedaekA...lealngtkldgrplrvewaklkgerekellgkilggr
00504771   1/1  .kivsvril......kskgfafVeFenpedAa--------------------------------------
00508081   1/1  vrivrd......kgfafVeFeseedaekA...lealngkeldgrplrvelakpkeerp------------
00504761   1/1  vkilrd......kgfAfVeFeseedaekAlealngtp---------------------------------
00522231   1/1  vrllrd......kgfafVeFedeedaekA...lealngteldgrplrvelakpkeerd------------
00504811   1/1  svrv........skgfafVeFedeedaekA...iealngkeldgrplrvelakpkkergsgggg------
00505651   1/1  vkv........skgfAfVefespesAqaA...iealnglellgrplkvkfakskeerlsgkssgdsl---
00489841   1/1  vsvrilrdk.....kgfafVeFedeedaekA...lealngkelggrplrvelakpk.elrrsrgrgrsrg
00508041   1/1  vkvvrd.......gfafVeFeseedaekA...ieklngteldgrrlrvelarpkerrrsslgrggggg--
00520821   1/1  vkilrd......rgfafVefedpedaekA...iealngkelggrplrvelakpkse--------------
00505121   1/1  ......lltgkskgfafVefeneedaqkA...iealngtelkgrplvVelakpkelrlsgpssg------
00508071   1/1  svrllrd......kgfAfVefetredAeaA...iealslngkelggrplrvefakpkk------------
00524421   1/1  teedlrelfskfG...evksvkvprd....----------------------------------------
00508051   1/1  svkvlrd......kgfAfVefeteedAeaalealnglglllgg.rplrvslsk-----------------
00505671   1/1  svrivrdkn......fafVeFedeedaekA...lealngkeldgrplrvelak............rgrfg
00524291   1/1  vlsvkilrdknskgfafVefesledalkA...iealnglllggrplrvslaksk----------------


                         -         -         -         +         -         -         -:280
query           DDRSRSSSAGFNSPVQGMNFGMGNTGGYRGGRGGGFNRGGMNMGGFNANRNFSNPMGSGGFQGGAMGGAG
00471971   1/1  ----------------------------------------------------------------------
00498011   1/1  ----------------------------------------------------------------------
00471081   1/1  Velakpkeerrrr---------------------------------------------------------
00522431   1/1  ----------------------------------------------------------------------
00522401   1/1  ----------------------------------------------------------------------
00522361   1/1  ----------------------------------------------------------------------
00522321   1/1  ----------------------------------------------------------------------
00486821   1/1  ----------------------------------------------------------------------
00498431   1/1  ----------------------------------------------------------------------
00508391   1/1  ----------------------------------------------------------------------
00505151   1/1  ----------------------------------------------------------------------
00378341   1/1  ----------------------------------------------------------------------
00476311   1/1  ----------------------------------------------------------------------
00493341   1/1  ----------------------------------------------------------------------
00494921   1/1  ----------------------------------------------------------------------
00467851   1/1  grgggrggggg-----------------------------------------------------------
00416531   1/1  ----------------------------------------------------------------------
00486801   1/1  ----------------------------------------------------------------------
00522391   1/1  ----------------------------------------------------------------------
00508091   1/1  ----------------------------------------------------------------------
00462861   1/1  ----------------------------------------------------------------------
00458931   1/1  ----------------------------------------------------------------------
00522311   1/1  ----------------------------------------------------------------------
00361651   1/1  ----------------------------------------------------------------------
00508341   1/1  ----------------------------------------------------------------------
00533131   1/1  ----------------------------------------------------------------------
00508061   1/1  ----------------------------------------------------------------------
00522211   1/1  ----------------------------------------------------------------------
00468761   1/1  ----------------------------------------------------------------------
00471721   1/1  ----------------------------------------------------------------------
00522291   1/1  ----------------------------------------------------------------------
00522181   1/1  ----------------------------------------------------------------------
00522381   1/1  ----------------------------------------------------------------------
00508031   1/1  ----------------------------------------------------------------------
00497691   1/1  ----------------------------------------------------------------------
00522191   1/1  ----------------------------------------------------------------------
00474221   1/1  ----------------------------------------------------------------------
00508371   1/1  ----------------------------------------------------------------------
00504661   1/1  ----------------------------------------------------------------------
00522451   1/1  ----------------------------------------------------------------------
00484001   1/1  ----------------------------------------------------------------------
00467941   1/1  ----------------------------------------------------------------------
00508381   1/1  ----------------------------------------------------------------------
00462871   1/1  ----------------------------------------------------------------------
00505661   1/1  ----------------------------------------------------------------------
00494161   1/1  tlgglgrgg-------------------------------------------------------------
00505771   1/1  ----------------------------------------------------------------------
00467951   1/1  ----------------------------------------------------------------------
00462201   1/1  ----------------------------------------------------------------------
00528991   1/1  ----------------------------------------------------------------------
00522221   1/1  ----------------------------------------------------------------------
00504781   1/1  ----------------------------------------------------------------------
00454791   1/1  ----------------------------------------------------------------------
00457471   1/1  ----------------------------------------------------------------------
00522301   1/1  ----------------------------------------------------------------------
00528971   1/1  ----------------------------------------------------------------------
00504791   1/1  ----------------------------------------------------------------------
00453731   1/1  ----------------------------------------------------------------------
00522351   1/1  ----------------------------------------------------------------------
00428601   1/1  ----------------------------------------------------------------------
00526221   1/1  gggggggggggggg--------------------------------------------------------
00508021   1/1  ----------------------------------------------------------------------
00522481   1/1  ----------------------------------------------------------------------
00528981   1/1  ----------------------------------------------------------------------
00505141   1/1  ----------------------------------------------------------------------
00517481   1/1  ----------------------------------------------------------------------
00524411   1/1  ----------------------------------------------------------------------
00522171   1/1  ----------------------------------------------------------------------
00505761   1/1  ----------------------------------------------------------------------
00504801   1/1  ----------------------------------------------------------------------
00497751   1/1  ----------------------------------------------------------------------
00505681   1/1  ----------------------------------------------------------------------
00522441   1/1  ----------------------------------------------------------------------
00498881   1/1  ----------------------------------------------------------------------
00522331   1/1  ----------------------------------------------------------------------
00522341   1/1  ----------------------------------------------------------------------
00420611   1/1  gsrlgrrrggg-----------------------------------------------------------
00504771   1/1  ----------------------------------------------------------------------
00508081   1/1  ----------------------------------------------------------------------
00504761   1/1  ----------------------------------------------------------------------
00522231   1/1  ----------------------------------------------------------------------
00504811   1/1  ----------------------------------------------------------------------
00505651   1/1  ----------------------------------------------------------------------
00489841   1/1  lsrgrlrggllglglgg..---------------------------------------------------
00508041   1/1  ----------------------------------------------------------------------
00520821   1/1  ----------------------------------------------------------------------
00505121   1/1  ----------------------------------------------------------------------
00508071   1/1  ----------------------------------------------------------------------
00524421   1/1  ----------------------------------------------------------------------
00508051   1/1  ----------------------------------------------------------------------
00505671   1/1  arprgrgsgrgllllllglllll-----------------------------------------------
00524291   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FQGTPVGGMQPYGGFGNRGGMMGSNMRGGPNMRGRGGMGGPMGGNMMPVGGMGGVGMGGMGMGGMGGMGG
00471971   1/1  ----------------------------------------------------------------------
00498011   1/1  ----------------------------------------------------------------------
00471081   1/1  ----------------------------------------------------------------------
00522431   1/1  ----------------------------------------------------------------------
00522401   1/1  ----------------------------------------------------------------------
00522361   1/1  ----------------------------------------------------------------------
00522321   1/1  ----------------------------------------------------------------------
00486821   1/1  ----------------------------------------------------------------------
00498431   1/1  ----------------------------------------------------------------------
00508391   1/1  ----------------------------------------------------------------------
00505151   1/1  ----------------------------------------------------------------------
00378341   1/1  ----------------------------------------------------------------------
00476311   1/1  ----------------------------------------------------------------------
00493341   1/1  ----------------------------------------------------------------------
00494921   1/1  ----------------------------------------------------------------------
00467851   1/1  ----------------------------------------------------------------------
00416531   1/1  ----------------------------------------------------------------------
00486801   1/1  ----------------------------------------------------------------------
00522391   1/1  ----------------------------------------------------------------------
00508091   1/1  ----------------------------------------------------------------------
00462861   1/1  ----------------------------------------------------------------------
00458931   1/1  ----------------------------------------------------------------------
00522311   1/1  ----------------------------------------------------------------------
00361651   1/1  ----------------------------------------------------------------------
00508341   1/1  ----------------------------------------------------------------------
00533131   1/1  ----------------------------------------------------------------------
00508061   1/1  ----------------------------------------------------------------------
00522211   1/1  ----------------------------------------------------------------------
00468761   1/1  ----------------------------------------------------------------------
00471721   1/1  ----------------------------------------------------------------------
00522291   1/1  ----------------------------------------------------------------------
00522181   1/1  ----------------------------------------------------------------------
00522381   1/1  ----------------------------------------------------------------------
00508031   1/1  ----------------------------------------------------------------------
00497691   1/1  ----------------------------------------------------------------------
00522191   1/1  ----------------------------------------------------------------------
00474221   1/1  ----------------------------------------------------------------------
00508371   1/1  ----------------------------------------------------------------------
00504661   1/1  ----------------------------------------------------------------------
00522451   1/1  ----------------------------------------------------------------------
00484001   1/1  ----------------------------------------------------------------------
00467941   1/1  ----------------------------------------------------------------------
00508381   1/1  ----------------------------------------------------------------------
00462871   1/1  ----------------------------------------------------------------------
00505661   1/1  ----------------------------------------------------------------------
00494161   1/1  ----------------------------------------------------------------------
00505771   1/1  ----------------------------------------------------------------------
00467951   1/1  ----------------------------------------------------------------------
00462201   1/1  ----------------------------------------------------------------------
00528991   1/1  ----------------------------------------------------------------------
00522221   1/1  ----------------------------------------------------------------------
00504781   1/1  ----------------------------------------------------------------------
00454791   1/1  ----------------------------------------------------------------------
00457471   1/1  ----------------------------------------------------------------------
00522301   1/1  ----------------------------------------------------------------------
00528971   1/1  ----------------------------------------------------------------------
00504791   1/1  ----------------------------------------------------------------------
00453731   1/1  ----------------------------------------------------------------------
00522351   1/1  ----------------------------------------------------------------------
00428601   1/1  ----------------------------------------------------------------------
00526221   1/1  ----------------------------------------------------------------------
00508021   1/1  ----------------------------------------------------------------------
00522481   1/1  ----------------------------------------------------------------------
00528981   1/1  ----------------------------------------------------------------------
00505141   1/1  ----------------------------------------------------------------------
00517481   1/1  ----------------------------------------------------------------------
00524411   1/1  ----------------------------------------------------------------------
00522171   1/1  ----------------------------------------------------------------------
00505761   1/1  ----------------------------------------------------------------------
00504801   1/1  ----------------------------------------------------------------------
00497751   1/1  ----------------------------------------------------------------------
00505681   1/1  ----------------------------------------------------------------------
00522441   1/1  ----------------------------------------------------------------------
00498881   1/1  ----------------------------------------------------------------------
00522331   1/1  ----------------------------------------------------------------------
00522341   1/1  ----------------------------------------------------------------------
00420611   1/1  ----------------------------------------------------------------------
00504771   1/1  ----------------------------------------------------------------------
00508081   1/1  ----------------------------------------------------------------------
00504761   1/1  ----------------------------------------------------------------------
00522231   1/1  ----------------------------------------------------------------------
00504811   1/1  ----------------------------------------------------------------------
00505651   1/1  ----------------------------------------------------------------------
00489841   1/1  ----------------------------------------------------------------------
00508041   1/1  ----------------------------------------------------------------------
00520821   1/1  ----------------------------------------------------------------------
00505121   1/1  ----------------------------------------------------------------------
00508071   1/1  ----------------------------------------------------------------------
00524421   1/1  ----------------------------------------------------------------------
00508051   1/1  ----------------------------------------------------------------------
00505671   1/1  ----------------------------------------------------------------------
00524291   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           MPNQMGGMMGGMQGGMGMQGQGFQGQNPHFNPAFFGQHGGSDGAWNPHGAKRTRQE--------------
00471971   1/1  ----------------------------------------------------------------------
00498011   1/1  ----------------------------------------------------------------------
00471081   1/1  ----------------------------------------------------------------------
00522431   1/1  ----------------------------------------------------------------------
00522401   1/1  ----------------------------------------------------------------------
00522361   1/1  ----------------------------------------------------------------------
00522321   1/1  ----------------------------------------------------------------------
00486821   1/1  ----------------------------------------------------------------------
00498431   1/1  ----------------------------------------------------------------------
00508391   1/1  ----------------------------------------------------------------------
00505151   1/1  ----------------------------------------------------------------------
00378341   1/1  ----------------------------------------------------------------------
00476311   1/1  ----------------------------------------------------------------------
00493341   1/1  ----------------------------------------------------------------------
00494921   1/1  ----------------------------------------------------------------------
00467851   1/1  ----------------------------------------------------------------------
00416531   1/1  ----------------------------------------------------------------------
00486801   1/1  ----------------------------------------------------------------------
00522391   1/1  ----------------------------------------------------------------------
00508091   1/1  ----------------------------------------------------------------------
00462861   1/1  ----------------------------------------------------------------------
00458931   1/1  ----------------------------------------------------------------------
00522311   1/1  ----------------------------------------------------------------------
00361651   1/1  ----------------------------------------------------------------------
00508341   1/1  ----------------------------------------------------------------------
00533131   1/1  ----------------------------------------------------------------------
00508061   1/1  ----------------------------------------------------------------------
00522211   1/1  ----------------------------------------------------------------------
00468761   1/1  ----------------------------------------------------------------------
00471721   1/1  ----------------------------------------------------------------------
00522291   1/1  ----------------------------------------------------------------------
00522181   1/1  ----------------------------------------------------------------------
00522381   1/1  ----------------------------------------------------------------------
00508031   1/1  ----------------------------------------------------------------------
00497691   1/1  ----------------------------------------------------------------------
00522191   1/1  ----------------------------------------------------------------------
00474221   1/1  ----------------------------------------------------------------------
00508371   1/1  ----------------------------------------------------------------------
00504661   1/1  ----------------------------------------------------------------------
00522451   1/1  ----------------------------------------------------------------------
00484001   1/1  ----------------------------------------------------------------------
00467941   1/1  ----------------------------------------------------------------------
00508381   1/1  ----------------------------------------------------------------------
00462871   1/1  ----------------------------------------------------------------------
00505661   1/1  ----------------------------------------------------------------------
00494161   1/1  ----------------------------------------------------------------------
00505771   1/1  ----------------------------------------------------------------------
00467951   1/1  ----------------------------------------------------------------------
00462201   1/1  ----------------------------------------------------------------------
00528991   1/1  ----------------------------------------------------------------------
00522221   1/1  ----------------------------------------------------------------------
00504781   1/1  ----------------------------------------------------------------------
00454791   1/1  ----------------------------------------------------------------------
00457471   1/1  ----------------------------------------------------------------------
00522301   1/1  ----------------------------------------------------------------------
00528971   1/1  ----------------------------------------------------------------------
00504791   1/1  ----------------------------------------------------------------------
00453731   1/1  ----------------------------------------------------------------------
00522351   1/1  ----------------------------------------------------------------------
00428601   1/1  ----------------------------------------------------------------------
00526221   1/1  ----------------------------------------------------------------------
00508021   1/1  ----------------------------------------------------------------------
00522481   1/1  ----------------------------------------------------------------------
00528981   1/1  ----------------------------------------------------------------------
00505141   1/1  ----------------------------------------------------------------------
00517481   1/1  ----------------------------------------------------------------------
00524411   1/1  ----------------------------------------------------------------------
00522171   1/1  ----------------------------------------------------------------------
00505761   1/1  ----------------------------------------------------------------------
00504801   1/1  ----------------------------------------------------------------------
00497751   1/1  ----------------------------------------------------------------------
00505681   1/1  ----------------------------------------------------------------------
00522441   1/1  ----------------------------------------------------------------------
00498881   1/1  ----------------------------------------------------------------------
00522331   1/1  ----------------------------------------------------------------------
00522341   1/1  ----------------------------------------------------------------------
00420611   1/1  ----------------------------------------------------------------------
00504771   1/1  ----------------------------------------------------------------------
00508081   1/1  ----------------------------------------------------------------------
00504761   1/1  ----------------------------------------------------------------------
00522231   1/1  ----------------------------------------------------------------------
00504811   1/1  ----------------------------------------------------------------------
00505651   1/1  ----------------------------------------------------------------------
00489841   1/1  ----------------------------------------------------------------------
00508041   1/1  ----------------------------------------------------------------------
00520821   1/1  ----------------------------------------------------------------------
00505121   1/1  ----------------------------------------------------------------------
00508071   1/1  ----------------------------------------------------------------------
00524421   1/1  ----------------------------------------------------------------------
00508051   1/1  ----------------------------------------------------------------------
00505671   1/1  ----------------------------------------------------------------------
00524291   1/1  ----------------------------------------------------------------------