[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00411


[Show Plain Result]

## Summary of Sequence Search
   1::1056
 816::1009 7.8e-58 52.1% 0043066 00430662 2/2   Q domain                                
  20::138    1e-27 35.3% 0038769 00387691 1/1   VHS domain                              
  19::138  8.3e-24 30.8% 0038572 00385721 1/1   VHS domain                              
  20::143  4.1e-14 22.6% 0047397 00473971 1/1   VHS domain                              
  17::142  1.2e-13 23.0% 0046653 00466531 1/1   VHS domain                              
 905::1024 2.3e-06 22.5% 0049410 00494101 1/1   Q domain                                
 159::282  0.00047 19.7% 0038571 00385711 1/1   ike domain                              
 591::661        5 15.5% 0043066 00430661 1/2   Q domain                                
   1::1056


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSMAYNSTVTRNIDMSRTEADLAVNIRKATSIEETAPKRKHVRSCIVYTWDHKSSASFWAGMKVQPVLAD
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  -------------------qdlekaVrkATshdesgpkekhvreiivatheskaslqelmdalkrrllds
00385721   1/1  ------------------aselevaVrkATshdewgpkgkhlreiivlthssraslaeivdallkrlldt
00473971   1/1  -------------------klllllvkellrkaknvllnyseleklvkeATsndlwgPkskllaeildlt
00466531   1/1  ----------------lgyseleklvkeATsndlwgPkskllleildltysvesfleivkvllkRLldkg
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EVQTFKALITVHKVLQEGHPITVKEAQSHVPWLDSLVRGVAGEGLRGYGPLIREYVFYLESKLAFHRQHP
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  nwrvvlKaLillhyllrnGserflqelasrrnllnlsnfldksdlqsldlgvligslgydygkfvrry--
00385721   1/1  nwrvvlKaLillhyllrnGservlqdlasrrnllnlsnfldytssdgkdqgalvreyakyLderlldy--
00473971   1/1  ynyesyleimkvllkRLndkgknwrvvyKaLilleyLlknGservvlelrsnlyllellsdfqyidengk
00466531   1/1  knwrvvyKaLilleyLlknGservvlelrsnilllellkdfvyidengkdqglnvrekakyllallrdde
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EFNGLFEYEEYISLKSINDPNEGYETITDLMALQDQIDAFQKLIFSHFRGGANNECRISALVPLVQESYG
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  dqg-------------------------------------------------------------------
00466531   1/1  ll--------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ------------------ggddsrlrtlsveklldklealqrlldallkcrptgaalnngvvlaAflllv
00430661   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IYKFITSMLRAMHTTTGDEEALEPLRGRYDAQHYRLVRFYYECSNLRYLTSLITVPKLPQQPPNLLAEDE
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  kdslklYaalndgvinllekffelsrpdakkaleiykrflkqteelveFlsvaksvglar..ldiPelkh
00430661   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DRPALPKRPSKEVEKEPTPPPKSTIPDPEPINDFWSTEAKRQQEEYEAEQRRLQQQWEDQQRQQMLAQQQ
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ip--------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AQRDFEEQQRLQAEQQRLAQEQLLRDQYQQQTQGRLAELEQENLNARAQYERDQLLLQQYDKRVKDLEEQ
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LNQLNSNYNLQNTSKDDQIRALQEQVNTWRSKYEALAKLYSQLRQEHLDLLQTTKSLKLKAASAQEAIDK
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RERLEREMKTKNLELADMIRERDRALHEKDRISGGNKEELEKVKRELRLAIERAENAERAKSSEISAMLS
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KYNREMADLEEALRNKNRALEEARNSTGERDHDHELTLREKDEEIEVYKSGMEQALMELEELKLNQGDVD
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ------------------------------nlkleelgdlvekellaaaaaieealkkledllnksraln


                         -         +         -         -         -         -         *:700
query           KALDTQIDDVLLSSVTKINDIIDSVLQSGVQRVDDALYELDSTMQAGNQNASPPYVLSQIEKASASATEF
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  sglelevneeileaakalikavaaLvqaate---------------------------------------


                         -         -         -         -         +         -         -:770
query           STAFNNFIADGPNSAHSEIIRTVSVFSGSIADVLSNTKGLTRFATDDKKADQLINAARQSAQSTMTFFRA
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LQSFRLQDLEPLQKTDVVINNNHEVALNLQKLSKLVDAFAPKSTKLNGTGDLGDLVDRELSNAANAIEAA
00430662   2/2  ---------------------------------------------nlkleelgdlvekellaaaaaieea
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           AARLAKLKKKPRDGYSTYELRIHDSILEASIAVTTAIAELIKAATASQQEIVREGRGSSSRTAFYKKNNR
00430662   2/2  lkkledllnksralnsglelevneeileaakalikavaaLvqaateaqkeivkegkeaesdlefykknsr
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------seedre
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           WTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASNDVAASTAQLVAASRVKATFMSKTQDRLET
00430662   2/2  WteGLisAAkavadatavLveaadglvaggsseeqLivaakevaastaqlvaAsrvkadlnskalerLeq
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  lqdlllalakavanataalvlkakniaakaedealqnrviaaatqCalatsqlvaCakvvaPtisspaCq
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           ASKAVGAACRALVRQVQAIIAEKNRDETEAVDYSKLSGHEFKVREMEQQVEILQLENKLSQARQRLGEMR
00430662   2/2  aakavadatanlvksvkglqaqleeenel-----------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  eqlieaarevakavenllevaeeatndeellkdlsaaarevska--------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           KISYLE----------------------------------------------------------------
00430662   2/2  ----------------------------------------------------------------------
00387691   1/1  ----------------------------------------------------------------------
00385721   1/1  ----------------------------------------------------------------------
00473971   1/1  ----------------------------------------------------------------------
00466531   1/1  ----------------------------------------------------------------------
00494101   1/1  ----------------------------------------------------------------------
00385711   1/1  ----------------------------------------------------------------------
00430661   1/2  ----------------------------------------------------------------------