[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00429


[Show Plain Result]

## Summary of Sequence Search
   1::476
 348::455  2.8e-15 28.4% 0047903 00479031 1/1   ne-fold                                 
 330::450    3e-14 23.3% 0040304 00403041 1/1   ne-fold                                 
 352::449  1.2e-13 21.6% 0047348 00473481 1/1   ne-fold                                 
 371::455  1.8e-12 36.7% 0038978 00389781 1/1   ne-fold                                 
 325::453  5.3e-11 24.4% 0037328 00373281 1/1   ne-fold                                 
 374::464  8.8e-11 28.7% 0041190 00411901 1/1   ne-fold                                 
 374::447    6e-10 33.8% 0035368 00353681 1/1   ne-fold                                 
 374::447  1.1e-09 30.9% 0034938 00349381 1/1   ne-fold                                 
 374::445    2e-09 33.3% 0040265 00402651 1/1   ne-fold                                 
 373::446  1.6e-08 27.5% 0047118 00471181 1/1   ne-fold                                 
 375::448  3.2e-08 32.4% 0049583 00495831 1/1   ne-fold                                 
 370::445  6.4e-08 27.1% 0049584 00495841 1/1   ne-fold                                 
 377::447  2.5e-06 28.4% 0052079 00520791 1/1   ne-fold                                 
 376::458  9.1e-05 26.9% 0041191 00411911 1/1   ne-fold                                 
   1::476


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSPSGPDALRITPRRRRGSAGAGPSPAHNTPSSILQQLAGMAGDPATPAGRSRRSLSASRVSLRRSSRG
00479031   1/1  ----------------------------------------------------------------------
00403041   1/1  ----------------------------------------------------------------------
00473481   1/1  ----------------------------------------------------------------------
00389781   1/1  ----------------------------------------------------------------------
00373281   1/1  ----------------------------------------------------------------------
00411901   1/1  ----------------------------------------------------------------------
00353681   1/1  ----------------------------------------------------------------------
00349381   1/1  ----------------------------------------------------------------------
00402651   1/1  ----------------------------------------------------------------------
00471181   1/1  ----------------------------------------------------------------------
00495831   1/1  ----------------------------------------------------------------------
00495841   1/1  ----------------------------------------------------------------------
00520791   1/1  ----------------------------------------------------------------------
00411911   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VSGIGISDAFAGGSHAPATPHALKAFQRRAAVYTPGRDRRKSGRVQRETPLDILRNLGKALAPTSEVIKS
00479031   1/1  ----------------------------------------------------------------------
00403041   1/1  ----------------------------------------------------------------------
00473481   1/1  ----------------------------------------------------------------------
00389781   1/1  ----------------------------------------------------------------------
00373281   1/1  ----------------------------------------------------------------------
00411901   1/1  ----------------------------------------------------------------------
00353681   1/1  ----------------------------------------------------------------------
00349381   1/1  ----------------------------------------------------------------------
00402651   1/1  ----------------------------------------------------------------------
00471181   1/1  ----------------------------------------------------------------------
00495831   1/1  ----------------------------------------------------------------------
00495841   1/1  ----------------------------------------------------------------------
00520791   1/1  ----------------------------------------------------------------------
00411911   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SPMTETDQETDQQESEDLDEEPDLPRPRLSLPMHEMIVPGDGDGSPEIVPPRLSLPLDEDDFTQRSIEMP
00479031   1/1  ----------------------------------------------------------------------
00403041   1/1  ----------------------------------------------------------------------
00473481   1/1  ----------------------------------------------------------------------
00389781   1/1  ----------------------------------------------------------------------
00373281   1/1  ----------------------------------------------------------------------
00411901   1/1  ----------------------------------------------------------------------
00353681   1/1  ----------------------------------------------------------------------
00349381   1/1  ----------------------------------------------------------------------
00402651   1/1  ----------------------------------------------------------------------
00471181   1/1  ----------------------------------------------------------------------
00495831   1/1  ----------------------------------------------------------------------
00495841   1/1  ----------------------------------------------------------------------
00520791   1/1  ----------------------------------------------------------------------
00411911   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RRERSTRDLATLSRYSLASTRFSEHFGDASRLEYTEEGMEFTAPQGDDNFVDDQIELTAEQPIFDLGGET
00479031   1/1  ----------------------------------------------------------------------
00403041   1/1  ----------------------------------------------------------------------
00473481   1/1  ----------------------------------------------------------------------
00389781   1/1  ----------------------------------------------------------------------
00373281   1/1  ----------------------------------------------------------------------
00411901   1/1  ----------------------------------------------------------------------
00353681   1/1  ----------------------------------------------------------------------
00349381   1/1  ----------------------------------------------------------------------
00402651   1/1  ----------------------------------------------------------------------
00471181   1/1  ----------------------------------------------------------------------
00495831   1/1  ----------------------------------------------------------------------
00495841   1/1  ----------------------------------------------------------------------
00520791   1/1  ----------------------------------------------------------------------
00411911   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EDLRRFDLNFSFPTPDAPQHIENEHEDFVLDTTMPIADDVPVSSDDDFGAGDLELAVREGSPRPPLQESS
00479031   1/1  -------------------------------------------------------------------sgg
00403041   1/1  -------------------------------------------------artkqtarketggkaprkgaa
00473481   1/1  ----------------------------------------------------------------------
00389781   1/1  ----------------------------------------------------------------------
00373281   1/1  --------------------------------------------edelalldlllrqnvgsddlssddsd
00411901   1/1  ----------------------------------------------------------------------
00353681   1/1  ----------------------------------------------------------------------
00349381   1/1  ----------------------------------------------------------------------
00402651   1/1  ----------------------------------------------------------------------
00471181   1/1  ----------------------------------------------------------------------
00495831   1/1  ----------------------------------------------------------------------
00495841   1/1  ----------------------------------------------------------------------
00520791   1/1  ----------------------------------------------------------------------
00411911   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PQPPQESRLDQNKERVSKHGIPVPKLPRGIVKRLATRFARTGNGSRTRISKEALAALEKATDWFFEQAND
00479031   1/1  gkggkglgkgglkeirklsrsgdlllpkarikrlarei...gv...kriskdalealqealelfleelle
00403041   1/1  tkaagkkapstggakkprrkrrgtvalreirklqkstdlllpklpfarlvkeilkqv.....pddlriss
00473481   1/1  -pkrkrpgtvalreirrlqkstdlllpkapfarlvreillkldgd.lrisseAiealqeaveaflvelae
00389781   1/1  --------------------stdlllpkapikrlakeigvk......riskealealaealeefleelle
00373281   1/1  qinsllplvaeevallaalslsagggkgllkggakrliklleieivgrekdllLPlarikrimk......
00411901   1/1  -----------------------llLPlarikrimke....vlpdvlriskdalealqealelfilllts
00353681   1/1  -----------------------lllPkarikrllke......ggdlrissealvalaealedfieelle
00349381   1/1  -----------------------lllPkarikrllke......dgdvrissdalvllaealelfieelle
00402651   1/1  -----------------------lllpkarikrllke......ggdlrissealvalaealeefleelle
00471181   1/1  ----------------------drllpkapllrlvkei.....dgnlriskdaielLlelaeefielvle
00495831   1/1  ------------------------plplrlvrrilkslgve......rissdallallealerylvdlle
00495841   1/1  -------------------lllllllplasirriaksv......gvkrisddalellaeavelfleeile
00520791   1/1  --------------------------Plarikrimkeal....pdvlriskealealaeaaelfilylts
00411911   1/1  -------------------------lPlarvkrimkl.....dpdvlriskdapvalakalelfiaelle


                         -         -         +         -         -         -         -:490
query           DLSAYSKHSNRKTVDETDVIALMKRQRQIGKGTSVFALAQKYLPKELLQDIRLAKK--------------
00479031   1/1  daalyarhakRktitaeDvllalrrlgfllylfgl-----------------------------------
00403041   1/1  eAllalqeaaedflerlaedanllAkhakR----------------------------------------
00473481   1/1  danllarhakRkTitakDiqlalrllglv-----------------------------------------
00389781   1/1  davlyaehakRktvtveDvllalrrlgellygfdl-----------------------------------
00373281   1/1  lpdvkriskeAvellaealeefiseltseAsey-------------------------------------
00411901   1/1  eAselaehakrktitaedvllalrrlgfldflldlvellekyke--------------------------
00353681   1/1  eAlllakhakrktitardiqlalrllg-------------------------------------------
00349381   1/1  eAsllakhakrktitprdiqlalrllg-------------------------------------------
00402651   1/1  eAvllaehakrktitprdillAlrl---------------------------------------------
00471181   1/1  eaaelAkhakrktieaeDillalerl--------------------------------------------
00495831   1/1  davlyaehakrktvtaeDvklAlklrge------------------------------------------
00495841   1/1  dAlklarhakRktltaeDiqlAlrl---------------------------------------------
00520791   1/1  eAaelaehekrktitaedillaleelg-------------------------------------------
00411911   1/1  lAlllarhekrktitpedillAlknlgfldflldlvpk--------------------------------